Overview

  • Product name

    Anti-HLA Class II DRB1 antibody
    See all HLA Class II DRB1 primary antibodies
  • Description

    Rabbit polyclonal to HLA Class II DRB1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human HLA Class II DRB1 aa 30-266.
    Sequence:

    GDTRPRFLEYSTGECYFFNGTERVRLLERHFHNQEELLRFDSDVGEFRAV TELGRPVAESWNSQKDILEDRRAAVDTYCRHNYGAVESFTVQRRVHPKVT VYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHN GDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKML SGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPRGFLS


    Database link: Q95IE3

  • Positive control

    • WB: A-375 and Raji whole cell lysates. ICC/IF: A-375 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235953 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 30 kDa.

Target

Images

  • All lanes : Anti-HLA Class II DRB1 antibody (ab235953) at 1/1000 dilution

    Lane 1 : A-375 (Human malignant melanoma cell line) whole cell lysate
    Lane 2 : Raji (Human Burkitt's lymphoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 30 kDa

  • A-375 (Human malignant melanoma cell line) cells stained for HLA Class II DRB1 (Green) using ab235953 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab235953 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235953.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up