Overview

  • Product name

    Anti-HLA Class II DRB1 antibody (FITC)
    See all HLA Class II DRB1 primary antibodies
  • Description

    Rabbit polyclonal to HLA Class II DRB1 (FITC)
  • Host species

    Rabbit
  • Conjugation

    FITC. Ex: 493nm, Em: 528nm
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human HLA Class II DRB1 aa 31-266.
    Sequence:

    DTRPRFLEYSTSECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAVT ELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGVVESFTVQRRVHPKVTV YPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNG DWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLS GVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPRGFLS


    Database link: P01912

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Caprylic Acid - Ammonium Sulfate precipitation
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab193620 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/50 - 1/100. Predicted molecular weight: 30 kDa.

Target

References

ab193620 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193620.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up