Overview

  • Product name

    Anti-HLA-DOA antibody
  • Description

    Rabbit polyclonal to HLA-DOA
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human HLA-DOA aa 26-135.
    Sequence:

    TKADHMGSYGPAFYQSYGASGQFTHEFDEEQLFSVDLKKSEAVWRLPEFG DFARFDPQGGLAGIAAIKAHLDILVERSNRSRAINVPPRVTVLPKSRVEL GQPNILICIV


    Database link: P06340

  • Positive control

    • IHC-P: Human skeletal muscle and skin tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224668 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Relevance

    HLA-DOA belongs to the HLA class II alpha chain paralogues. HLA-DOA forms a heterodimer with HLA-DOB. The heterodimer, HLA-DO, is found in lysosomes in B cells and regulates HLA-DM-mediated peptide loading on MHC class II molecules. In comparison with classical HLA class II molecules, this gene exhibits very little sequence variation, especially at the protein level.
  • Cellular localization

    Cell Membrane; Single-pass type I membrane protein.
  • Database links

  • Alternative names

    • HLA class II histocompatibility antigen, DO alpha chain precursor antibody
    • HLA D0 alpha antibody
    • HLA DNA antibody
    • HLA DZA antibody
    • HLADZ antibody
    • Lymphocyte antigen antibody
    • Major histocompatibility complex, class II, DN alpha antibody
    • Major histocompatibility complex, class II, DO alpha antibody
    • MHC class II antigen DOA antibody
    • MHC DN alpha antibody
    • MHC DZ alpha antibody
    see all

Images

  • Paraffin-embedded human skeletal muscle tissue stained for HLA-DOA using ab224668 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human skin tissue stained for HLA-DOA using ab224668 at 1/100 dilution in immunohistochemical analysis.

References

ab224668 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224668.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up