Overview

  • Product name

  • Description

    Rabbit polyclonal to HLA-DQB1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human HLA-DQB1 aa 128-175.
    Sequence:

    EPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVV


    Database link: P01920

  • Positive control

    • IHC: Human skin and lymph node tissue. WB: NIH/3T3 cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Clonality

    Polyclonal
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224600 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/3000. Detects a band of approximately 30 kDa (predicted molecular weight: 30 kDa).
IHC-P 1/20 - 1/200.

Target

  • Function

    Binds peptides derived from antigens that access the endocytic route of antigen presenting cells (APC) and presents them on the cell surface for recognition by the CD4 T-cells. The peptide binding cleft accommodates peptides of 10-30 residues. The peptides presented by MHC class II molecules are generated mostly by degradation of proteins that access the endocytic route, where they are processed by lysosomal proteases and other hydrolases. Exogenous antigens that have been endocytosed by the APC are thus readily available for presentation via MHC II molecules, and for this reason this antigen presentation pathway is usually referred to as exogenous. As membrane proteins on their way to degradation in lysosomes as part of their normal turn-over are also contained in the endosomal/lysosomal compartments, exogenous antigens must compete with those derived from endogenous components. Autophagy is also a source of endogenous peptides, autophagosomes constitutively fuse with MHC class II loading compartments. In addition to APCs, other cells of the gastrointestinal tract, such as epithelial cells, express MHC class II molecules and CD74 and act as APCs, which is an unusual trait of the GI tract. To produce a MHC class II molecule that presents an antigen, three MHC class II molecules (heterodimers of an alpha and a beta chain) associate with a CD74 trimer in the ER to form a heterononamer. Soon after the entry of this complex into the endosomal/lysosomal system where antigen processing occurs, CD74 undergoes a sequential degradation by various proteases, including CTSS and CTSL, leaving a small fragment termed CLIP (class-II-associated invariant chain peptide). The removal of CLIP is facilitated by HLA-DM via direct binding to the alpha-beta-CLIP complex so that CLIP is released. HLA-DM stabilizes MHC class II molecules until primary high affinity antigenic peptides are bound. The MHC II molecule bound to a peptide is then transported to the cell membrane surface. In B-cells, the interaction between HLA-DM and MHC class II molecules is regulated by HLA-DO. Primary dendritic cells (DCs) also to express HLA-DO. Lysosomal microenvironment has been implicated in the regulation of antigen loading into MHC II molecules, increased acidification produces increased proteolysis and efficient peptide loading.
  • Sequence similarities

    Belongs to the MHC class II family.
    Contains 1 Ig-like C1-type (immunoglobulin-like) domain.
  • Cellular localization

    Cell membrane. Endoplasmic reticulum membrane. Golgi apparatus, trans-Golgi network membrane. Endosome membrane. Lysosome membrane. The MHC class II complex transits through a number of intracellular compartments in the endocytic pathway until it reaches the cell membrane for antigen presentation.
  • Information by UniProt
  • Database links

  • Alternative names

    • CELIAC1 antibody
    • DQ beta 1 chain antibody
    • DQB1_HUMAN antibody
    • HLA class II histocompatibility antigen antibody
    • HLA class II histocompatibility antigen, DQ beta 1 chain antibody
    • HLA class II histocompatibility antigen, DQ beta 2 chain antibody
    • HLA DQB antibody
    • HLA DQB1 antibody
    • HLA-DQB1 antibody
    • HLA-DQB2 antibody
    • IDDM1 antibody
    • Lymphocyte antigen antibody
    • Major histocompatibility complex class II beta antibody
    • Major histocompatibility complex, class II, DQ beta 1 antibody
    • MHC class II antigen DQB1 antibody
    • MHC class II antigen HLA DQ beta 1 antibody
    • MHC class II DQ beta chain antibody
    • MHC class II HLA DQ beta glycoprotein antibody
    • MHC class2 antigen antibody
    • MHC DQ beta antibody
    • OTTHUMP00000029167 antibody
    • OTTHUMP00000178569 antibody
    • OTTHUMP00000178570 antibody
    • OTTHUMP00000178571 antibody
    see all

Images

  • Paraffin-embedded human skin tissue stained for HLA-DQB1 using ab224600 at 1/100 dilution in immunohistochemical analysis.

  • Anti-HLA-DQB1 antibody (ab224600) at 1/200 dilution + NIH/3T3 (mouse embryo fibroblast cell line) cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 30 kDa
    Observed band size: 30 kDa

  • Paraffin-embedded human lymph node tissue stained for HLA-DQB1 using ab224600 at 1/100 dilution in immunohistochemical analysis.

References

ab224600 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224600.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up