Anti-HLA-DR antibody (ab231004)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-HLA-DR antibody
See all HLA-DR primary antibodies -
Description
Rabbit polyclonal to HLA-DR -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Rabbit -
Immunogen
Recombinant fragment corresponding to Rabbit HLA-DR aa 26-211. (NM_001171118.1). (Expressed in E.coli).
Sequence:AIKEEHVIIQAEYFLSPDDLGEFMFDFDGDEIFHVDMDKKETVWRLKEFG QFASFEAQGALANIAVDRANLDIMIKRSNHTPDTNVPPEVTLLPSSPVEL GEPNVLICFIDKFSPPVINVTWLRNGNPVTMGVSETVFLPRDDHLFRKFH YLPFLPSTEDVYDCKVEHWGLEEPTLKHWEFEARTPLPETTENVVC
-
Positive control
- WB: Rabbit spleen, lymph and thymus lysates; Recombinant rabbit HLA-DR protein.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
Followed by protein A chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab231004 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 29 kDa. |
Target
-
Function
Binds peptides derived from antigens that access the endocytic route of antigen presenting cells (APC) and presents them on the cell surface for recognition by the CD4 T-cells. The peptide binding cleft accommodates peptides of 10-30 residues. The peptides presented by MHC class II molecules are generated mostly by degradation of proteins that access the endocytic route, where they are processed by lysosomal proteases and other hydrolases. Exogenous antigens that have been endocytosed by the APC are thus readily available for presentation via MHC II molecules, and for this reason this antigen presentation pathway is usually referred to as exogenous. As membrane proteins on their way to degradation in lysosomes as part of their normal turn-over are also contained in the endosomal/lysosomal compartments, exogenous antigens must compete with those derived from endogenous components. Autophagy is also a source of endogenous peptides, autophagosomes constitutively fuse with MHC class II loading compartments. In addition to APCs, other cells of the gastrointestinal tract, such as epithelial cells, express MHC class II molecules and CD74 and act as APCs, which is an unusual trait of the GI tract. To produce a MHC class II molecule that presents an antigen, three MHC class II molecules (heterodimers of an alpha and a beta chain) associate with a CD74 trimer in the ER to form an heterononamer. Soon after the entry of this complex into the endosomal/lysosomal system where antigen processing occurs, CD74 undergoes a sequential degradation by various proteases, including CTSS and CTSL, leaving a small fragment termed CLIP (class-II-associated invariant chain peptide). The removal of CLIP is facilitated by HLA-DM via direct binding to the alpha-beta-CLIP complex so that CLIP is released. HLA-DM stabilizes MHC class II molecules until primary high affinity antigenic peptides are bound. The MHC II molecule bound to a peptide is then transported to the cell membrane surface. In B-cells, the interaction between HLA-DM and MHC class II molecules is regulated by HLA-DO. Primary dendritic cells (DCs) also to express HLA-DO. Lysosomal miroenvironment has been implicated in the regulation of antigen loading into MHC II molecules, increased acidification produces increased proteolysis and efficient peptide loading. -
Sequence similarities
Belongs to the MHC class II family.
Contains 1 Ig-like C1-type (immunoglobulin-like) domain. -
Post-translational
modificationsUbiquitinated by MARCH1 or MARCH8 at Lys-244 leading to down-regulation of MHC class II. When associated with ubiquitination of the beta subunit of HLA-DR: HLA-DRB4 'Lys-254', the down-regulation of MHC class II may be highly effective. -
Cellular localization
Cell membrane. Endoplasmic reticulum membrane. Golgi apparatus > trans-Golgi network membrane. Endosome membrane. Lysosome membrane. Late endosome membrane. The MHC class II complex transits through a number of intracellular compartments in the endocytic pathway until it reaches the cell membrane for antigen presentation. - Information by UniProt
-
Alternative names
- DASS-397D15.1 antibody
- DR alpha chain antibody
- DR alpha chain precursor antibody
see all
Images
-
All lanes : Anti-HLA-DR antibody (ab231004) at 3 µg/ml
Lane 1 : Rabbit spleen tissue
Lane 2 : Rabbit lymph tissue
Lane 3 : Rabbit thymus tissue
Secondary
All lanes : HRP-Linked Rabbit Anti-Guinea IgG antibody at 1/5000 dilution
Predicted band size: 29 kDa -
Anti-HLA-DR antibody (ab231004) at 3 µg/ml + Recombinant MHCDRa protein
Secondary
HRP-Linked Rabbit Anti-Guinea IgG antibody at 1/5000 dilution
Predicted band size: 29 kDa
Datasheets and documents
References
ab231004 has not yet been referenced specifically in any publications.