Overview

  • Product name

    Anti-HLA G antibody [87G] (Alexa Fluor® 488)
    See all HLA G primary antibodies
  • Description

    Mouse monoclonal [87G] to HLA G (Alexa Fluor® 488)
  • Host species

    Mouse
  • Conjugation

    Alexa Fluor® 488. Ex: 495nm, Em: 519nm
  • Specificity

    ab187576 recognizes both membrane-bound and soluble forms of HLA G (HLA G1 and HLA G5). ab187576 blocks interaction of HLA G with inhibitory receptors.
  • Tested applications

    Suitable for: Flow Cytmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: ChimpanzeeDoes not react with: Mouse, Rat
  • Immunogen

    Full length protein corresponding to Human HLA G aa 1-338. HLA-B27 transgenic mice were imunized with H-2 identical murine cells transfected with and expressing genes encoding HLA G and Human beta 2 Microglobulin.
    Sequence:

    MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMG YVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRM NLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLAL NEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGK EMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQ DVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQ SSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD


    Database link: P17693

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot. Store at +4°C. Do Not Freeze. Store In the Dark.
  • Storage buffer

    pH: 7.4
    Preservative: 0.097% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Size exclusion
  • Purification notes

    ab187576 is conjugated with Alexa Fluor® 488 under optimum conditions. The conjugate is purified by size-exclusion chromatography.
  • Clonality

    Monoclonal
  • Clone number

    87G
  • Isotype

    IgG2a
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab187576 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt Use a concentration of 15 µg/ml.

ab171464 - Mouse monoclonal IgG2a, is suitable for use as an isotype control with this antibody.

 

Target

  • Function

    Involved in the presentation of foreign antigens to the immune system. Plays a role in maternal tolerance of the fetus by mediating protection from the deleterious effects of natural killer cells, cytotoxic T lymphocytes, macrophages and mononuclear cells.
  • Tissue specificity

    Expressed in trophoblasts.
  • Sequence similarities

    Belongs to the MHC class I family.
    Contains 1 Ig-like C1-type (immunoglobulin-like) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • B2 microglobulin antibody
    • DADB-15K14.8 antibody
    • HLA 6.0 antibody
    • HLA class I histocompatibility antigen alpha chain G antibody
    • HLA class I histocompatibility antigen, alpha chain G antibody
    • HLA class I molecule antibody
    • HLA G antibody
    • HLA G antigen antibody
    • HLA G histocompatibility antigen class I G antibody
    • HLA G3 antibody
    • HLA-G antibody
    • HLA-G histocompatibility antigen, class I antibody
    • HLA60 antibody
    • HLAG antibody
    • HLAG_HUMAN antibody
    • Major histocompatibility complex class I G antibody
    • MHC class I antigen antibody
    • MHC class I antigen G antibody
    • MHC G antibody
    • T-cell A locus antibody
    • TCA antibody
    see all

References

ab187576 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187576.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up