Anti-HMBS/PBGD antibody (ab222899)
Key features and details
- Rabbit polyclonal to HMBS/PBGD
- Suitable for: IHC-P, ICC/IF, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-HMBS/PBGD antibody
See all HMBS/PBGD primary antibodies -
Description
Rabbit polyclonal to HMBS/PBGD -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, ICC/IF, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat -
Immunogen
Recombinant fragment corresponding to Human HMBS/PBGD aa 283-330.
Sequence:WSLDGSDSIQETMQATIHVPAQHEDGPEDDPQLVGITARNIPRGPQLA
Database link: P08397 -
Positive control
- WB: Raji whole cell lysate. ICC/IF: HepG2 cells. IHC-P: Human melanoma cancer and colon cancer tissue.
-
General notes
This product was previously labelled as HMBS
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), PBS, 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity >95% -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab222899 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/20 - 1/200. | |
ICC/IF | 1/50 - 1/200. | |
WB | 1/500 - 1/5000. |
Target
-
Function
Tetrapolymerization of the monopyrrole PBG into the hydroxymethylbilane pre-uroporphyrinogen in several discrete steps. -
Tissue specificity
Isoform 1 is ubiquitously expressed. Isoform 2 is found only in erythroid cells. -
Pathway
Porphyrin metabolism; protoporphyrin-IX biosynthesis; coproporphyrinogen-III from 5-aminolevulinate: step 2/4. -
Involvement in disease
Defects in HMBS are the cause of acute intermittent porphyria (AIP) [MIM:176000]. AIP is a form of porphyria. Porphyrias are inherited defects in the biosynthesis of heme, resulting in the accumulation and increased excretion of porphyrins or porphyrin precursors. They are classified as erythropoietic or hepatic, depending on whether the enzyme deficiency occurs in red blood cells or in the liver. AIP is an autosomal dominant form of hepatic porphyria characterized by acute attacks of neurological dysfunctions with abdominal pain, hypertension, tachycardia, and peripheral neuropathy. Most attacks are precipitated by drugs, alcohol, caloric deprivation, infections, or endocrine factors. -
Sequence similarities
Belongs to the HMBS family. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 3145 Human
- Entrez Gene: 15288 Mouse
- Entrez Gene: 25709 Rat
- Omim: 609806 Human
- SwissProt: P08397 Human
- SwissProt: P22907 Mouse
- SwissProt: P19356 Rat
- Unigene: 82609 Human
see all -
Alternative names
- HEM3_HUMAN antibody
- HMBS antibody
- Hydroxymethylbilane synthase antibody
see all
Images
-
Raji (human Burkitt's lymphoma cell line) cells stained for HMBS/PBGD (green) using ab222899 (4 µg/ml) in ICC/IF. Secondary: Alexa Fluor® 488-conjugated Goat Anti-Rabbit IgG (H+L).
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HMBS/PBGD antibody (ab222899)
Paraffin embedded human colon cancer tissue stained for HMBS/PBGD with ab222899 (1/100 dilution) in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HMBS/PBGD antibody (ab222899)
Paraffin embedded human melanoma cancer tissue stained for HMBS/PBGD with ab222899 (1/100 dilution) in immunohistochemical analysis.
-
Anti-HMBS/PBGD antibody (ab222899) at 1/500 dilution + Raji (human Burkitt's lymphoma cell line) whole cell lysate
Secondary
Goat polyclonal to rabbit IgG at 1/500000 dilution
Protocols
References (0)
ab222899 has not yet been referenced specifically in any publications.