For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    hmbspbgd-antibody-ab222899.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Metabolism Vitamins / Minerals
Share by email

Anti-HMBS/PBGD antibody (ab222899)

  • Datasheet
  • SDS
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunocytochemistry/ Immunofluorescence - Anti-HMBS/PBGD antibody (ab222899)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HMBS/PBGD antibody (ab222899)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HMBS/PBGD antibody (ab222899)
  • Western blot - Anti-HMBS/PBGD antibody (ab222899)

Key features and details

  • Rabbit polyclonal to HMBS/PBGD
  • Suitable for: IHC-P, ICC/IF, WB
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Protein
Product image
Recombinant Human HMBS/PBGD protein (ab123176)
Secondary
Product image
Goat Anti-Rabbit IgG H&L (HRP) (ab205718)

View more associated products

Overview

  • Product name

    Anti-HMBS/PBGD antibody
    See all HMBS/PBGD primary antibodies
  • Description

    Rabbit polyclonal to HMBS/PBGD
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human HMBS/PBGD aa 283-330.
    Sequence:

    WSLDGSDSIQETMQATIHVPAQHEDGPEDDPQLVGITARNIPRGPQLA


    Database link: P08397
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: Raji whole cell lysate. ICC/IF: HepG2 cells. IHC-P: Human melanoma cancer and colon cancer tissue.
  • General notes

     This product was previously labelled as HMBS

     

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Constituents: 50% Glycerol (glycerin, glycerine), PBS, 0.03% Proclin 300
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Signal Transduction
    • Metabolism
    • Vitamins / Minerals
    • Cell Biology
    • Other Antibodies
    • Other Antibodies
    • Metabolism
    • Pathways and Processes
    • Cofactors, Vitamins / minerals
    • Vitamins / minerals

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
  • Positive Controls

    • Raji whole cell lysate (ab30124)
  • Recombinant Protein

    • Recombinant Human HMBS/PBGD protein (ab123176)
  • Related Products

    • Recombinant Human HMBS/PBGD protein (ab123176)

Applications

Our Abpromise guarantee covers the use of ab222899 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.
WB 1/500 - 1/5000.

Target

  • Function

    Tetrapolymerization of the monopyrrole PBG into the hydroxymethylbilane pre-uroporphyrinogen in several discrete steps.
  • Tissue specificity

    Isoform 1 is ubiquitously expressed. Isoform 2 is found only in erythroid cells.
  • Pathway

    Porphyrin metabolism; protoporphyrin-IX biosynthesis; coproporphyrinogen-III from 5-aminolevulinate: step 2/4.
  • Involvement in disease

    Defects in HMBS are the cause of acute intermittent porphyria (AIP) [MIM:176000]. AIP is a form of porphyria. Porphyrias are inherited defects in the biosynthesis of heme, resulting in the accumulation and increased excretion of porphyrins or porphyrin precursors. They are classified as erythropoietic or hepatic, depending on whether the enzyme deficiency occurs in red blood cells or in the liver. AIP is an autosomal dominant form of hepatic porphyria characterized by acute attacks of neurological dysfunctions with abdominal pain, hypertension, tachycardia, and peripheral neuropathy. Most attacks are precipitated by drugs, alcohol, caloric deprivation, infections, or endocrine factors.
  • Sequence similarities

    Belongs to the HMBS family.
  • Cellular localization

    Cytoplasm.
  • Target information above from: UniProt accession P08397 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 3145 Human
    • Entrez Gene: 15288 Mouse
    • Entrez Gene: 25709 Rat
    • Omim: 609806 Human
    • SwissProt: P08397 Human
    • SwissProt: P22907 Mouse
    • SwissProt: P19356 Rat
    • Unigene: 82609 Human
    • Unigene: 247676 Mouse
    • Unigene: 11080 Rat
    see all
  • Alternative names

    • HEM3_HUMAN antibody
    • HMBS antibody
    • Hydroxymethylbilane synthase antibody
    • PBG D antibody
    • PBG-D antibody
    • PBGD antibody
    • PORC antibody
    • Porphobilinogen deaminase antibody
    • porphyria, acute; Chester type antibody
    • Pre uroporphyrinogen synthase antibody
    • Pre-uroporphyrinogen synthase antibody
    • UPS antibody
    • Uroporphyrinogen I synthase antibody
    • Uroporphyrinogen I synthetase antibody
    see all

Images

  • Immunocytochemistry/ Immunofluorescence - Anti-HMBS/PBGD antibody (ab222899)
    Immunocytochemistry/ Immunofluorescence - Anti-HMBS/PBGD antibody (ab222899)

    Raji (human Burkitt's lymphoma cell line) cells stained for HMBS/PBGD (green) using ab222899 (4 µg/ml) in ICC/IF. Secondary: Alexa Fluor® 488-conjugated Goat Anti-Rabbit IgG (H+L).

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HMBS/PBGD antibody (ab222899)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HMBS/PBGD antibody (ab222899)

    Paraffin embedded human colon cancer tissue stained for HMBS/PBGD with ab222899 (1/100 dilution) in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HMBS/PBGD antibody (ab222899)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HMBS/PBGD antibody (ab222899)

    Paraffin embedded human melanoma cancer tissue stained for HMBS/PBGD with ab222899 (1/100 dilution) in immunohistochemical analysis.

  • Western blot - Anti-HMBS/PBGD antibody (ab222899)
    Western blot - Anti-HMBS/PBGD antibody (ab222899)
    Anti-HMBS/PBGD antibody (ab222899) at 1/500 dilution + Raji (human Burkitt's lymphoma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/500000 dilution

Protocols

  • Immunohistochemistry protocols
  • Immunocytochemistry & immunofluorescence protocols
  • Western blot protocols

Click here to view the general protocols

Datasheets and documents

    • Datasheet
    • SDS
  • References (0)

    Publishing research using ab222899? Please let us know so that we can cite the reference in this datasheet.

    ab222899 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab222899.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.