
  • Product name
    Anti-HMGB1 antibody [HAP46.5]
    See all HMGB1 primary antibodies
  • Description
    Mouse monoclonal [HAP46.5] to HMGB1
  • Host species
  • Tested applications
    Suitable for: WB, ELISAmore details
    Unsuitable for: ICC/IF
  • Species reactivity
    Reacts with: Mouse, Rat, Chicken, Dog, Human
  • Immunogen

    Recombinant full length protein (Human).

  • Positive control
    • Total cell extract of human MCF breast carcinoma cells.



Our Abpromise guarantee covers the use of ab12029 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 1 µg/ml. Detects a band of approximately 25 kDa (predicted molecular weight: 25 kDa).
ELISA Use at an assay dependent dilution.
  • Application notes
    Is unsuitable for ICC/IF.
  • Target

    • Function
      Multifunctional redox sensitive protein with various roles in different cellular compartments. In the nucleus is one of the major chromatin-associated non-histone proteins and acts as a DNA chaperone involved in replication, transcription, chromatin remodeling, V(D)J recombination, DNA repair and genome stability. Proposed to be an universal biosensor for nucleic acids. Promotes host inflammatory response to sterile and infectious signals and is involved in the coordination and integration of innate and adaptive immune responses. In the cytoplasm functions as sensor and/or chaperone for immunogenic nucleic acids implicating the activation of TLR9-mediated immune responses, and mediates autophagy. Acts as danger associated molecular pattern (DAMP) molecule that amplifies immune responses during tissue injury. Released to the extracellular environment can bind DNA, nucleosomes, IL-1 beta, CXCL12, AGER isoform 2/sRAGE, lipopolysaccharide (LPS) and lipoteichoic acid (LTA), and activates cells through engagement of multiple surface receptors. In the extracellular compartment fully reduced HMGB1 (released by necrosis) acts as a chemokine, disulfide HMGB1 (actively secreted) as a cytokine, and sulfonyl HMGB1 (released from apoptotic cells) promotes immunological tolerance (PubMed:23519706, PubMed:23446148, PubMed:23994764, PubMed:25048472). Has proangiogdenic activity (By similarity). May be involved in platelet activation (By similarity). Binds to phosphatidylserine and phosphatidylethanolamide (By similarity). Bound to RAGE mediates signaling for neuronal outgrowth (By similarity). May play a role in accumulation of expanded polyglutamine (polyQ) proteins such as huntingtin (HTT) or TBP (PubMed:23303669, PubMed:25549101).
      Nuclear functions are attributed to fully reduced HGMB1. Associates with chromatin and binds DNA with a preference to non-canonical DNA structures such as single-stranded DNA, DNA-containing cruciforms or bent structures, supercoiled DNA and ZDNA. Can bent DNA and enhance DNA flexibility by looping thus providing a mechanism to promote activities on various gene promoters by enhancing transcription factor binding and/or bringing distant regulatory sequences into close proximity (PubMed:20123072). May have an enhancing role in nucleotide excision repair (NER) (By similarity). However, effects in NER using in vitro systems have been reported conflictingly (PubMed:19446504, PubMed:19360789). May be involved in mismatch repair (MMR) and base excision repair (BER) pathways (PubMed:15014079, PubMed:16143102, PubMed:17803946). May be involved in double strand break repair such as non-homologous end joining (NHEJ) (By similarity). Involved in V(D)J recombination by acting as a cofactor of the RAG complex: acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS) (By similarity). In vitro can displace histone H1 from highly bent DNA (By similarity). Can restructure the canonical nucleosome leading to relaxation of structural constraints for transcription factor-binding (By similarity). Enhances binding of sterol regulatory element-binding proteins (SREBPs) such as SREBF1 to their cognate DNA sequences and increases their transcriptional activities (By similarity). Facilitates binding of TP53 to DNA (PubMed:23063560). Proposed to be involved in mitochondrial quality control and autophagy in a transcription-dependent fashion implicating HSPB1; however, this function has been questioned (By similarity). Can modulate the activity of the telomerase complex and may be involved in telomere maintenance.
      In the cytoplasm proposed to dissociate the BECN1:BCL2 complex via competitive interaction with BECN1 leading to autophagy activation (PubMed:20819940). Involved in oxidative stress-mediated autophagy (PubMed:21395369). Can protect BECN1 and ATG5 from calpain-mediated cleavage and thus proposed to control their proautophagic and proapoptotic functions and to regulate the extent and severity of inflammation-associated cellular injury (By similarity). In myeloid cells has a protective role against endotoxemia and bacterial infection by promoting autophagy (By similarity). Involved in endosomal translocation and activation of TLR9 in response to CpG-DNA in macrophages.
      In the extracellular compartment (following either active secretion or passive release) involved in regulation of the inflammatory response. Fully reduced HGMB1 (which subsequently gets oxidized after release) in association with CXCL12 mediates the recruitment of inflammatory cells during the initial phase of tissue injury; the CXCL12:HMGB1 complex triggers CXCR4 homodimerization (PubMed:22370717). Induces the migration of monocyte-derived immature dendritic cells and seems to regulate adhesive and migratory functions of neutrophils implicating AGER/RAGE and ITGAM (By similarity). Can bind to various types of DNA and RNA including microbial unmethylated CpG-DNA to enhance the innate immune response to nucleic acids. Proposed to act in promiscuous DNA/RNA sensing which cooperates with subsequent discriminative sensing by specific pattern recognition receptors (By similarity). Promotes extracellular DNA-induced AIM2 inflammasome activation implicating AGER/RAGE (PubMed:24971542). Disulfide HMGB1 binds to transmembrane receptors, such as AGER/RAGE, TLR2, TLR4 and probably TREM1, thus activating their signal transduction pathways. Mediates the release of cytokines/chemokines such as TNF, IL-1, IL-6, IL-8, CCL2, CCL3, CCL4 and CXCL10 (PubMed:12765338, PubMed:18354232, PubMed:19264983, PubMed:20547845, PubMed:24474694). Promotes secretion of interferon-gamma by macrophage-stimulated natural killer (NK) cells in concert with other cytokines like IL-2 or IL-12 (PubMed:15607795). TLR4 is proposed to be the primary receptor promoting macrophage activation and signaling through TLR4 seems to implicate LY96/MD-2 (PubMed:20547845). In bacterial LPS- or LTA-mediated inflammatory responses binds to the endotoxins and transfers them to CD14 for signaling to the respective TLR4:LY96 and TLR2 complexes (PubMed:18354232, PubMed:21660935, PubMed:25660311). Contributes to tumor proliferation by association with ACER/RAGE (By similarity). Can bind to IL1-beta and signals through the IL1R1:IL1RAP receptor complex (PubMed:18250463). Binding to class A CpG activates cytokine production in plasmacytoid dendritic cells implicating TLR9, MYD88 and AGER/RAGE and can activate autoreactive B cells. Via HMGB1-containing chromatin immune complexes may also promote B cell responses to endogenous TLR9 ligands through a B-cell receptor (BCR)-dependent and ACER/RAGE-independent mechanism (By similarity). Inhibits phagocytosis of apoptotic cells by macrophages; the function is dependent on poly-ADP-ribosylation and involves binding to phosphatidylserine on the cell surface of apoptotic cells (By similarity). In adaptive immunity may be involved in enhancing immunity through activation of effector T cells and suppression of regulatory T (TReg) cells (PubMed:15944249, PubMed:22473704). In contrast, without implicating effector or regulatory T-cells, required for tumor infiltration and activation of T-cells expressing the lymphotoxin LTA:LTB heterotrimer thus promoting tumor malignant progression (By similarity). Also reported to limit proliferation of T-cells (By similarity). Released HMGB1:nucleosome complexes formed during apoptosis can signal through TLR2 to induce cytokine production (PubMed:19064698). Involved in induction of immunological tolerance by apoptotic cells; its pro-inflammatory activities when released by apoptotic cells are neutralized by reactive oxygen species (ROS)-dependent oxidation specifically on Cys-106 (PubMed:18631454). During macrophage activation by activated lymphocyte-derived self apoptotic DNA (ALD-DNA) promotes recruitment of ALD-DNA to endosomes.
    • Tissue specificity
      Ubiquituous. Expressed in platelets (PubMed:11154118).
    • Sequence similarities
      Belongs to the HMGB family.
      Contains 2 HMG box DNA-binding domains.
    • Domain
      HMG box 2 mediates proinflammatory cytokine-stimulating activity and binding to TLR4 (PubMed:12765338, PubMed:20547845). However, not involved in mediating immunogenic activity in the context of apoptosis-induced immune tolerance (PubMed:24474694).
      The acidic C-terminal domain forms a flexible structure which can reversibly interact intramolecularily with the HMG boxes and modulate binding to DNA and other proteins (PubMed:23063560).
    • Post-translational
      Phosphorylated at serine residues. Phosphorylation in both NLS regions is required for cytoplasmic translocation followed by secretion (PubMed:17114460).
      Acetylated on multiple sites upon stimulation with LPS (PubMed:22801494). Acetylation on lysine residues in the nuclear localization signals (NLS 1 and NLS 2) leads to cytoplasmic localization and subsequent secretion (By similarity). Acetylation on Lys-3 results in preferential binding to DNA ends and impairs DNA bending activity.
      Reduction/oxidation of cysteine residues Cys-23, Cys-45 and Cys-106 and a possible intramolecular disulfide bond involving Cys-23 and Cys-45 give rise to different redox forms with specific functional activities in various cellular compartments: 1- fully reduced HMGB1 (HMGB1C23hC45hC106h), 2- disulfide HMGB1 (HMGB1C23-C45C106h) and 3- sulfonyl HMGB1 (HMGB1C23soC45soC106so).
      Poly-ADP-ribosylated by PARP1 when secreted following stimulation with LPS.
      In vitro cleavage by CASP1 is liberating a HMG box 1-containing peptide which may mediate immunogenic activity; the peptide antagonizes apoptosis-induced immune tolerance (PubMed:24474694). Can be proteolytically cleaved by a thrombin:thrombomodulin complex; reduces binding to heparin and proinflammatory activities.
    • Cellular localization
      Nucleus. Chromosome. Cytoplasm. Secreted. Cell membrane. Endosome. Endoplasmic reticulum-Golgi intermediate compartment. In basal state predominantly nuclear. Shuttles between the cytoplasm and the nucleus (PubMed:12231511, PubMed:17114460). Translocates from the nucleus to the cytoplasm upon autophagy stimulation (PubMed:20819940). Release from macrophages in the extracellular milieu requires the activation of NLRC4 or NLRP3 inflammasomes (By similarity). Passively released to the extracellular milieu from necrotic cells by diffusion, involving the fully reduced HGMB1 which subsequently gets oxidized (PubMed:19811284). Also released from apoptic cells (PubMed:16855214, PubMed:18631454). Active secretion from a variety of immune and non-immune cells such as macrophages, monocytes, neutrophils, dendritic cells and natural killer cells in response to various stimuli such as LPS and cytokines involves a nonconventional secretory process via secretory lysosomes (PubMed:12231511, PubMed:14532127, PubMed:15944249). Secreted by plasma cells in response to LPS (By similarity). Found on the surface of activated platelets (PubMed:11154118).
    • Information by UniProt
    • Database links
    • Alternative names
      • Amphoterin antibody
      • Chromosomal protein, nonhistone, HMG1 antibody
      • DKFZp686A04236 antibody
      • High mobility group 1 antibody
      • High mobility group box 1 antibody
      • High mobility group protein 1 antibody
      • High mobility group protein B1 antibody
      • high-mobility group (nonhistone chromosomal) protein 1 antibody
      • HMG-1 antibody
      • HMG1 antibody
      • HMG3 antibody
      • HMGB 1 antibody
      • HMGB1 antibody
      • HMGB1_HUMAN antibody
      • SBP 1 antibody
      • Sulfoglucuronyl carbohydrate binding protein antibody
      see all


    This product has been referenced in:
    • O'Neill PR  et al. Membrane Flow Drives an Adhesion-Independent Amoeboid Cell Migration Mode. Dev Cell 46:9-22.e4 (2018). Read more (PubMed: 29937389) »
    • Finkel P  et al. The dual role of NK cells in antitumor reactions triggered by ionizing radiation in combination with hyperthermia. Oncoimmunology 5:e1101206 (2016). Read more (PubMed: 27471606) »
    See all 13 Publications for this product

    Customer reviews and Q&As

    1-10 of 14 Abreviews or Q&A


    Thank you for your reply. ECL is an appropriate reagent to use in Western blot, where the chemiluminescence can be developed on film. However, it can't be used in IHC. For IHC, we recommend using DAB or AEC substrate with an HRP-conjugated secondary antibody, or Fast Red substrate with an AP-conjugated secondary. We have DAB available as ab94665- https://www.abcam.com/DAB-substrate-kit-ab94665.html We also have AEC as ab64252- https://www.abcam.com/AEC-Substrate-System-Ready-to-Use-ab64252.html  And Fast Red as ab64254- https://www.abcam.com/Liquid-Fast-Red-Substrate-Kit-ab64254.html I hope this information will be useful, but if you have any further questions or need anything else, please let me know.

    Read More


    Thank you for contacting us with your question. We have only tested ab12029 in Western blot and ELISA, so it is possible that it will work in IHC, but we don't have any data in this application and we can not guarantee it. We have received some reports of background cytoplasmic staining in ICC (immunocytochemistry) on HeLa cells, so the protocol may need to be optimized if background staining is present.   For IHC using a purified antibody, we would recommend starting with 5 ug/mL, which would be ~1:400 dilution for ab12029. We also recommend blocking with 10% serum, and performing a heat-induced antigen retrieval with citrate buffer if the samples are paraffin-embedded and formalin-fixed. I hope this information is useful, but please let me know if you have any further questions and I'll be happy to help.

    Read More


    Thank you for your inquiry. I received confirmation that this antibody has not been epitope mapped. I am sorry that this information couldn't be more helpful, but please let me know if you have any other questions.   

    Read More


    Thank you for your reply. I understand the customers concerns, and it is likely this antibody is detecting HMGB2.  We appreciate the results and feedback, and apologize for any inconvenience. I have updated the datasheet with this information. In this case, I would be pleased to provide a credit note for these vials of  ab12029 the customer purchased. In order to arrange this, I would appreciate if you could please provide the Abcam order reference number and date of purchase for these vials. I have been in contact with our source again, who is investigating this further. It is possible they may do some crossreactivity testing, but regrettably this is not always feasible. Any information we obtain we will use to update the datasheet. Thank you for your cooperation. I look forward to hearing from you with the orders numbers and details of how you would like to proceed.  

    Read More


    Thank you for your enquiry. The immunogen for ab67282 HMGB2 antibody has very low alignment to the HMGB1 protein, so is not likely to detect HMGB1.  However, this has not been specifically tested in the laboratory. The ab12029 HMGB1 immunogen does have higher alignment to the HMGB2 protein, and so this antibody may also detect HMGB2, but I am sorry we do not have any experimental data to confirm this. I hope this information will be helpful to you. If you have any further questions please do not hesitate to contact us.  

    Read More


    Thank you for contacting us. I have looked into the antibodies that we have against HMGB1, in particular the antibodies you were enquiring about (ab12029 and ab18256), but unfortunately although we have may antibodies for this particular target, none have to our knowledge been tested to assess if they are neutralising. All the antibodies we stock against human HMGB1 can be found here: https://www.abcam.com/index.html?pageconfig=searchresults&search=HMGB1&pt=1&sk=targ&sv=HMGB1&sn=HMGB1&l=2&fViewMore=1 As discussed over the phone, if you were to use one of our antibodies in order to test if its neutralising you would be eligible for a testing discount. This would entitle you to a free primary antibody of your choice from our catalogue, the discount code is valid for 4 months. This discount code needs to be issued before purchase of the antibody to be tested so please let me know if you would like to proceed with this offer. The Terms and Conditions of this offer can be found at: www.abcam.com/collaborationdiscount. I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

    Read More


    Thank you for your enquiry. Unfortunately, we have not performed any epitope mapping on this antibody and we currently do not know where the epitope may be located. However, according to our database, the immunogen sequence is as follows: MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKA DKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNN TAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEE DEDEEEDDDDE I hope the information above will be useful to you. Should you require any other information, please do not hesitate to contact me.

    Read More


    Thank you for your enquiry. We did not determine the limit of detection for use of this antibody in an ELISA. Our aim was to determine if it worked in ELISA under standard conditions. Below is the ELISA procedure used: 1. Use a 96 well plate (from Falcon poly-vinyl) with 1 microgram per well of HMG1 (Sigma, Product No. H 4652) in PBS, overnight 4 deg C. 2. Wash with PBS/Tween 0.05% 3. Incubate with the primary antibody anti-HMG1 at 1 microgram/ml for 2 hours at room temperature. 4. Wash with PBS/Tween 0.05% (three times, five minutes each) 5. Incubate with secondary HRP conjugated anti-mouse antibody for 2 hours at room temperature. 6. Wash with PBS/Tween 0.05% (three times, five minutes each) 7. Develop with 5-Aminosalicylic Acid (1mg/ml). I hope this information helps. Please do not hesitate to contact us if you need anything further.

    Read More


    Thank you for your enquiry. Unfortunately, we have not determined whether this antibody will cross react with HMGB2. A BLAST search shows that HMGB1 and HMGB2 share about 80% homology so there is a chance for cross reaction. Our files show that only a single 25KDa band was detected in our western blots. Unfortunately, the WB image is raw QC data and is considered proprietary information. I hope this information helps. Please do not hesitate to contact us again if you need anything further.

    Read More


    Thank you for your enquiry. ab12029 has indeed been shown to work using ELISA. I have been in touch with the source of this antibody and unfortunately I have been unable to obtain any information as to the ELISA protocol that was employed. It is stated as being suitable for ELISA because whilst we havent tested it personally it has been tested and validated by others using either direct or sandwich ELISA. Unfortunately we do not have another antibody against HMGB1 that has been tested using ELISA that I could recommend as a partner in sandwich ELISA. However, we have an excellent sandwich ELISA protocol located at the following web link: https://www.abcam.com/assets/pdf/protocols/Sandwich%20ELISA.pdf As part of our "Abpromise" we guarantee that our antibodies behave as detailed on our datasheets. If this is not the case we offer a replacement vial or a refund is the enquiry is made within 90 days of purchase. I hope this information helps, please do not hesitate to contact us if you need any more advice or information.

    Read More

    1-10 of 14 Abreviews or Q&A


    Sign up