Overview

  • Product name

  • Description

    Rabbit polyclonal to HMGB4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human HMGB4 aa 96-173.
    Sequence:

    PPSSFLLFCQDHYAQLKRENPNWSVVQVAKATGKMWSTATDLEKHPYEQR VALLRAKYFEELELYRKQCNARKKYRMS


    Database link: Q8WW32

  • Positive control

    • IHC-P: Human testis tissue. WB: HMGB4 overexpression HEK-293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab224500 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 22 kDa.

Target

  • Relevance

    High Mobility Group (HMG) proteins, a group of chromosomal proteins common to all eukaryotes, bind DNA in a non-sequence-specific fashion to promote chromatin function and gene regulation, helping with transcription, replication, recombination, and DNA repair. HMGB4 is HMG2-like, isoform 2, high-mobility group box 4. This gene can be found on Chromosome 1. HMGB4 contains two HMG-box regions, and is found in a variety of eukaryotic chromosomal proteins. HMGB proteins are phosphorylated to various extents. The existence of differentially modified forms increases the number of distinct HMGB protein variants in plant chromatin that may be adapted to certain functions.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • High mobility group box 4 antibody
    • High mobility group protein B4 antibody
    • HMG2 like antibody

Images

  • Paraffin-embedded human testis tissue stained for HMGB4 using ab224500 at 1/50 dilution in immunohistochemical analysis.

  • All lanes : Anti-HMGB4 antibody (ab224500) at 1/100 dilution

    Lane 1 : Vector only transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : HMGB4 overexpression HEK-293T cell lysate (Co-expressed with a C-terminal myc-DDK tag, ~3.1 kDa)

    Developed using the ECL technique.

    Predicted band size: 22 kDa

References

ab224500 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224500.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up