Overview

  • Product name

    Anti-HMGCR antibody [CL0260]
    See all HMGCR primary antibodies
  • Description

    Mouse monoclonal [CL0260] to HMGCR
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Hamster, Cow, Pig, Chinese hamster, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human HMGCR aa 458-725.
    Sequence:

    GAKFLSDAEIIQLVNAKHIPAYKLETLMETHERGVSIRRQLLSKKLSEPS SLQYLPYRDYNYSLVMGACCENVIGYMPIPVGVAGPLCLDEKEFQVPMAT TEGCLVASTNRGCRAIGLGGGASSRVLADGMTRGPVVRLPRACDSAEVKA WLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGRNLYIRFQSRSGDAMGM NMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVV CEAVIPAKVVREVLKTTT


    Database link: P04035

  • Positive control

    • IHC-P: Human breast cancer, liver, fallopian tube, testis and liver cancer tissue. WB: MCF-7 and HepG2 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab242315 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Paraffin-embedded human liver cancer tissue stained for HMGCR using ab242315 at 1/50 dilution in immunohistochemical analysis.

  • All lanes : Anti-HMGCR antibody [CL0260] (ab242315) at 1 µg/ml

    Lane 1 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate transfected with control siRNA
    Lane 2 : MCF7 lysate transfected with siRNA probe 1
    Lane 3 : MCF7 transfected with siRNA probe 2.
  • Paraffin-embedded human fallopian tube tissue stained for HMGCR using ab242315 at 1/50 dilution in immunohistochemical analysis.

  • All lanes : Anti-HMGCR antibody [CL0260] (ab242315) at 1 µg/ml

    Lane 1 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
    Lane 2 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
  • Paraffin-embedded human testis tissue stained for HMGCR using ab242315 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human liver tissue stained for HMGCR using ab242315 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human breast cancer tissue stained for HMGCR using ab242315 at 1/50 dilution in immunohistochemical analysis.

  • Negative Control:

    Paraffin-embedded human skeletal muscle tissue stained for HMGCR using ab242315 at 1/50 dilution in immunohistochemical analysis.

References

ab242315 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab242315.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up