Overview

  • Product name

  • Description

    Rabbit polyclonal to HMGCS2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human HMGCS2 aa 426-508.
    Sequence:

    SQDAAPGSPLDKLVSSTSDLPKRLASRKCVSPEEFTEIMNQREQFYHKVN FSPPGDTNSLFPGTWYLERVDEQHRRKYARRPV


    Database link: P54868

  • Positive control

    • IHC-P: Human liver and liver cancer tissue. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab236667 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/200 - 1/500.

Target

  • Function

    This enzyme condenses acetyl-CoA with acetoacetyl-CoA to form HMG-CoA, which is the substrate for HMG-CoA reductase.
  • Tissue specificity

    High expression in liver and colon. Low expression in testis, heart, skeletal muscle and kidney.
  • Pathway

    Metabolic intermediate biosynthesis; (R)-mevalonate biosynthesis; (R)-mevalonate from acetyl-CoA: step 2/3.
  • Involvement in disease

    Defects in HMGCS2 are the cause of HMG-CoA synthase deficiency (HMGCS deficiency) [MIM:605911]; also known as deficiency of mitochondrial 3-hydroxy-3-methylglutaryl-CoA synthase 2. Affected individuals present with severe hypoketotic hypoglycemia, mild hepatomegaly, or fatty liver, and a nondiagnostic pattern of urinary organic acids with increase of medium and short chain dicarboxylic acids.
  • Sequence similarities

    Belongs to the HMG-CoA synthase family.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • 3 hydroxy 3 methylglutaryl Coenzyme A synthase 2 (mitochondrial) antibody
    • 3 hydroxy 3 methylglutaryl Coenzyme A synthase 2 antibody
    • 3 hydroxy 3 methylglutaryl coenzyme A synthase antibody
    • 3-hydroxy-3-methylglutaryl coenzyme A synthase antibody
    • HMCS2_HUMAN antibody
    • HMG CoA synthase antibody
    • HMG-CoA synthase antibody
    • HMGCS 2 antibody
    • HMGCS2 antibody
    • Hydroxymethylglutaryl CoA synthase antibody
    • Hydroxymethylglutaryl CoA synthase mitochondrial antibody
    • Hydroxymethylglutaryl-CoA synthase antibody
    • mitochondrial antibody
    see all

Images

  • Paraffin-embedded human liver tissue stained for HMGCS2 using ab236667 at 1/400 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • Paraffin-embedded human liver cancer tissue stained for HMGCS2 using ab236667 at 1/400 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for HMGCS2 using ab236667 at 1/133 dilution in ICC/IF.

    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the primary antibody overnight at 4°C. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L).

References

ab236667 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236667.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up