Overview

  • Product name

  • Description

    Rabbit polyclonal to HMGE
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to Human HMGE aa 35-84 (N terminal).
    Sequence:

    NSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALAD


    Database link: NP_079472

  • Positive control

    • Human fetal small intestine lysate
  • General notes

    Previously labelled as GRPEL1.

Properties

Applications

Our Abpromise guarantee covers the use of ab104783 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 24 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. Seems to control the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins.
  • Sequence similarities

    Belongs to the GrpE family.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ25609 antibody
    • GREPEL 1 antibody
    • GREPEL1 antibody
    • GrpE like 1 antibody
    • GrpE like 1 mitochondrial antibody
    • GrpE like protein cochaperone antibody
    • GrpE protein homolog 1 mitochondrial antibody
    • GrpE protein homolog 1, mitochondrial antibody
    • GRPE1_HUMAN antibody
    • GRPEL 1 antibody
    • Grpel1 antibody
    • HMGE antibody
    • Mt GrpE#1 antibody
    • Mt-GrpE#1 antibody
    see all

Images

  • Anti-HMGE antibody (ab104783) at 1 µg/ml + Human fetal small intestine lysate at 10 µg

    Predicted band size: 24 kDa



    Gel concentration: 12%

References

ab104783 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab104783.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up