Overview

  • Product name

  • Description

    Rabbit polyclonal to HMGE
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human HMGE aa 1-217.
    Sequence:

    MAAQCVRLARRSLPALALSLRPSPRLLCTATKQKNSGQNLEEDMGQSEQK ADPPATEKTLLEEKVKLEEQLKETVEKYKRALADTENLRQRSQKLVEEAK LYGIQAFCKDLLEVADVLEKATQCVPKEEIKDDNPHLKNLYEGLVMTEVQ IQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYK LHGRTLRPALVGVVKEA


    Database link: Q9HAV7

  • Positive control

    • WB: A431 and HEK-293T whole cell lysates. IHC-P: Human colon cancer and adrenal gland tissues.
  • General notes

    Previously labelled as GRPEL1.

Properties

Applications

Our Abpromise guarantee covers the use of ab230391 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 24 kDa.

Target

  • Function

    Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. Seems to control the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins.
  • Sequence similarities

    Belongs to the GrpE family.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ25609 antibody
    • GREPEL 1 antibody
    • GREPEL1 antibody
    • GrpE like 1 antibody
    • GrpE like 1 mitochondrial antibody
    • GrpE like protein cochaperone antibody
    • GrpE protein homolog 1 mitochondrial antibody
    • GrpE protein homolog 1, mitochondrial antibody
    • GRPE1_HUMAN antibody
    • GRPEL 1 antibody
    • Grpel1 antibody
    • HMGE antibody
    • Mt GrpE#1 antibody
    • Mt-GrpE#1 antibody
    see all

Images

  • All lanes : Anti-HMGE antibody (ab230391) at 1/1000 dilution

    Lane 1 : A431 (human epidermoid carcinoma cell line) whole cell lysate
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate

    Secondary
    All lanes : Goat anti-rabbit IgG at 1/10000 dilution

    Predicted band size: 24 kDa

  • Paraffin-embedded human colon cancer tissue stained for HMGE using ab230391 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human adrenal gland tissue stained for HMGE using ab230391 at 1/100 dilution in immunohistochemical analysis.

References

ab230391 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230391.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up