Overview

  • Product name

  • Description

    Rabbit polyclonal to HMGN5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human HMGN5 aa 23-124.
    Sequence:

    LSAMLVPVTPEVKPKRTSSSRKMKTKSDMMEENIDTSAQAVAETKQEAVV EEDYNENAKNGEAKITEAPASEKEIVEVKEENIEDATEKGGEKKEAVAAE VK


    Database link: P82970

  • Positive control

    • ICC/IF: U-2 OS cells. IHC-P: Human testis tissue.
  • General notes

     This product was previously labelled as NSBP1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab223724 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Preferentially binds to euchromatin and modulates cellular transcription by counteracting linker histone-mediated chromatin compaction.
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Belongs to the HMGN family.
  • Domain

    Specifically targeted by its C-terminus to nucleosomes in euchromatin.
  • Cellular localization

    Nucleus. Associates with nucleosomes in euchromatin and is largely excluded from constitutive heterochromatin.
  • Information by UniProt
  • Database links

  • Alternative names

    • High mobility group nucleosome binding domain 5 antibody
    • High mobility group nucleosome-binding domain-containing protein 5 antibody
    • Hmgn5 antibody
    • HMGN5_HUMAN antibody
    • NBP 45 antibody
    • NSBP 1 antibody
    • NSBP1 antibody
    • Nucleosomal binding protein 1 antibody
    • Nucleosome binding protein 1 antibody
    • Nucleosome-binding protein 1 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for HMGN5 (green) using ab223724 (4 µg/ml) in ICC/IF.

  • Paraffin embedded human testis tissue stained for HMGN5 with ab223724 (1/200 dilution) in immunohistochemical analysis.

References

ab223724 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223724.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up