Anti-HNF-4-alpha antibody [K9218] (ab41898)
![Western blot - Anti-HNF-4-alpha antibody [K9218] (ab41898)](https://www.abcam.com/ps/products/41/ab41898/Images/ab41898-55283-anti-hnf-4-alpha-antibody-k9218-chip-grade-western-blot.jpg "Western blot - Anti-HNF-4-alpha antibody [K9218] (ab41898)")
Key features and details
- Mouse monoclonal [K9218] to HNF-4-alpha
- Suitable for: WB, IHC-P, ICC/IF, Flow Cyt
- Reacts with: Mouse, Rat, Human
- Isotype: IgG2a
Overview
-
Product name
Anti-HNF-4-alpha antibody [K9218]
See all HNF-4-alpha primary antibodies -
Description
Mouse monoclonal [K9218] to HNF-4-alpha -
Host species
Mouse -
Tested applications
Suitable for: WB, IHC-P, ICC/IF, Flow Cytmore details -
Species reactivity
Reacts with: Mouse, Rat, Human
Predicted to work with: Pig
-
Immunogen
Recombinant fragment corresponding to Human HNF-4-alpha aa 3-49.
Sequence:MADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNAPNSLGVSAL
-
Positive control
- Human liver hepatocytes and rat intestine epithelial cell.
-
General notes
This product was changed from ascites to tissue culture supernatant on 3rd April 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7
Preservative: 0.1% Sodium azide
Physiological saline. -
Concentration information loading... -
Purity
Tissue culture supernatant -
Clonality
Monoclonal -
Clone number
K9218 -
Isotype
IgG2a -
Research areas
- Epigenetics and Nuclear Signaling
- Transcription
- Polymerase associated factors
- Pol II Transcription
- Other
- Metabolism
- Pathways and Processes
- Metabolic signaling pathways
- Lipid and lipoprotein metabolism
- Lipid metabolism
- Metabolism
- Pathways and Processes
- Metabolic signaling pathways
- Lipid and lipoprotein metabolism
- Cholesterol Metabolism
- Metabolism
- Pathways and Processes
- Metabolic signaling pathways
- Lipid and lipoprotein metabolism
- Lipases
Associated products
-
ChIP Related Products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab41898 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use at an assay dependent concentration. Detects a band of approximately 53 kDa (predicted molecular weight: 53 kDa). | |
| IHC-P | Use at an assay dependent concentration. | |
| ICC/IF | Use at an assay dependent concentration. | |
| Flow Cyt | Use at an assay dependent concentration. ab170191 - Mouse monoclonal IgG2a, is suitable for use as an isotype control with this antibody. |
Target
-
Function
Transcriptionally controlled transcription factor. Binds to DNA sites required for the transcription of alpha 1-antitrypsin, apolipoprotein CIII, transthyretin genes and HNF1-alpha. May be essential for development of the liver, kidney and intestine. -
Involvement in disease
Defects in HNF4A are the cause of maturity-onset diabetes of the young type 1 (MODY1) [MIM:125850]; also symbolized MODY-1. MODY is a form of diabetes that is characterized by an autosomal dominant mode of inheritance, onset in childhood or early adulthood (usually before 25 years of age), a primary defect in insulin secretion and frequent insulin-independence at the beginning of the disease. -
Sequence similarities
Belongs to the nuclear hormone receptor family. NR2 subfamily.
Contains 1 nuclear receptor DNA-binding domain. -
Post-translational
modificationsPhosphorylated on tyrosine residue(s); phosphorylation is important for its DNA-binding activity. Phosphorylation may directly or indirectly play a regulatory role in the subnuclear distribution. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 3172 Human
- Entrez Gene: 15378 Mouse
- Entrez Gene: 25735 Rat
- Omim: 600281 Human
- SwissProt: P41235 Human
- SwissProt: P49698 Mouse
- SwissProt: P22449 Rat
- Unigene: 116462 Human
see all -
Alternative names
- FLJ39654 antibody
- FRTS4 antibody
- Hepatic nuclear factor 4 alpha antibody
see all
Images
-
Western blot - Anti-HNF-4-alpha antibody [K9218] (ab41898)Anti-HNF-4-alpha antibody [K9218] (ab41898) at 1 µg/ml + HepG2 (Human hepatocellular liver carcinoma cell line) Whole Cell Lysate at 10 µg
Secondary
Goat Anti-Mouse IgG H&L (HRP) preadsorbed (ab97040) at 1/5000 dilution
Developed using the ECL technique.
Performed under reducing conditions.
Predicted band size: 53 kDa
Observed band size: 53 kDa
Additional bands at: 108 kDa, 37 kDa. We are unsure as to the identity of these extra bands.
Exposure time: 4 minutesThis image was generated using the ascites version of the product.
-
![Immunocytochemistry/ Immunofluorescence - Anti-HNF-4-alpha antibody [K9218] (ab41898)](https://www.abcam.com/ps/products/41/ab41898/Images/ab41898-55284-anti-hnf-4-alpha-antibody-k9218-chip-grade-immunofluorescence.jpg)
Immunocytochemistry/ Immunofluorescence - Anti-HNF-4-alpha antibody [K9218] (ab41898)ICC/IF image of ab41898 stained HepG2 cells. The cells were 4% PFA fixed (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab41898, 1µg/ml) overnight at +4°C. The secondary antibody (green) was Alexa Fluor® 488 goat anti-mouse IgG (H+L) (ab150113) used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.
This image was generated using the ascites version of the product.
-
![Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HNF-4-alpha antibody [K9218] (ab41898)](https://www.abcam.com/ps/products/41/ab41898/Images/ab41898-55281-anti-hnf-4-alpha-antibody-k9218-chip-grade-immunohistochemistry.jpg)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HNF-4-alpha antibody [K9218] (ab41898)Image from Algamas-Dimantov A et al., J Lipid Res. 2012 Jun;53(6):1056-70. doi: 10.1194/jlr.M021949. Epub 2012 Feb 22. Fig 5.; The Journal of Lipid Research, June 2012, vol. 53 no. 6 1056-1070Immunohistochemical analysis of obese mouse colon tissue, staining HNF-4-alpha with ab41898 at 1/200 dilution.
This image was generated using the ascites version of the product.
-
![Flow Cytometry - Anti-HNF-4-alpha antibody [K9218] (ab41898)](https://www.abcam.com/ps/products/41/ab41898/Images/ab41898-55282-anti-hnf-4-alpha-antibody-k9218-chip-grade-flow-cytometry.jpg)
Flow Cytometry - Anti-HNF-4-alpha antibody [K9218] (ab41898)Overlay histogram showing HepG2 cells stained with ab41898 (red line). The cells were fixed with methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum (ab7481) / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab41898, 2µg/1x106 cells) for 30 min at 22°C. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22°C. Isotype control antibody (black line) was mouse IgG2a [ICIGG2A] (ab91361, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a significantly decreased signal in HepG2 cells fixed with 4% paraformaldehyde/permeabilized in 0.1% PBS-Tween used under the same conditions.
This image was generated using the ascites version of the product.
-
![Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HNF-4-alpha antibody [K9218] (ab41898)](https://www.abcam.com/ps/products/41/ab41898/Images/ab41898-55286-anti-hnf-4-alpha-antibody-k9218-chip-grade-immunohistochemistry.jpg)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HNF-4-alpha antibody [K9218] (ab41898)ab41898 staining HNF-4-alpha in human liver hepatocytes (10-20 ug/mL) by Immunohistochemistry, formalin-fixed paraffin embedded sections.
This image was generated using the ascites version of the product.
-
![Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HNF-4-alpha antibody [K9218] (ab41898)](https://www.abcam.com/ps/products/41/ab41898/Images/ab41898-55285-anti-hnf-4-alpha-antibody-k9218-chip-grade-immunohistochemistry.jpg)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HNF-4-alpha antibody [K9218] (ab41898)ab41898 staining HNF-4-alpha in Rat Intestine epithelial cell(10-20 ug/mL) by Immunohistochemistry, formalin-fixed paraffin embedded sections.
This image was generated using the ascites version of the product.
Protocols
References (68)
ab41898 has been referenced in 68 publications.
- Donde H et al. Tributyrin Inhibits Ethanol-Induced Epigenetic Repression of CPT-1A and Attenuates Hepatic Steatosis and Injury. Cell Mol Gastroenterol Hepatol 9:569-585 (2020). PubMed: 31654770
- Qin Y et al. Alterations in promoter interaction landscape and transcriptional network underlying metabolic adaptation to diet. Nat Commun 11:962 (2020). PubMed: 32075973
- Xing Y et al. Methylated Vnn1 at promoter regions induces asthma occurrence via the PI3K/Akt/NF?B-mediated inflammation in IUGR mice. Biol Open 9:N/A (2020). PubMed: 32139393
- Guo JW et al. Hepatocyte TMEM16A Deletion Retards NAFLD Progression by Ameliorating Hepatic Glucose Metabolic Disorder. Adv Sci (Weinh) 7:1903657 (2020). PubMed: 32440483
- Wilflingseder J et al. Enhancer and super-enhancer dynamics in repair after ischemic acute kidney injury. Nat Commun 11:3383 (2020). PubMed: 32636391
