Overview

  • Product name

  • Description

    Rabbit Polyclonal to HNF1 alpha
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human HNF1 aa 264-339.
    Sequence:

    VYNWFANRRKEEAFRHKLAMDTYSGPPPGPGPGPALPAHSSPGLPPPALS PSKVHGVRYGQPATSETAEVPSSSGG


    Database link: P20823

  • Positive control

    • Human small intestine tissue; RT-4 and U-251 MG cell lysates; Human liver tissue lysate; CACO-2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab204306 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 67 kDa.

Target

  • Function

    Transcriptional activator that regulates the tissue specific expression of multiple genes, especially in pancreatic islet cells and in liver. Required for the expression of several liver specific genes. Binds to the inverted palindrome 5'-GTTAATNATTAAC-3'.
  • Tissue specificity

    Liver.
  • Involvement in disease

    Defects in HNF1A are a cause of hepatic adenomas familial (HEPAF) [MIM:142330]. Hepatic adenomas are rare benign liver tumors of presumable epithelial origin that develop in an otherwise normal liver. Hepatic adenomas may be single or multiple. They consist of sheets of well-differentiated hepatocytes that contain fat and glycogen and can produce bile. Bile ducts or portal areas are absent. Kupffer cells, if present, are reduced in number and are non-functional. Conditions associated with adenomas are insulin-dependent diabetes mellitus and glycogen storage diseases (types 1 and 3). Note=Bi-allelic inactivation of HNF1A, whether sporadic or associated with MODY3, may be an early step in the developmant of some hepatocellular carcinomas.
    Defects in HNF1A are the cause of maturity-onset diabetes of the young type 3 (MODY3) [MIM:600496]; also symbolized MODY-3. MODY is a form of diabetes that is characterized by an autosomal dominant mode of inheritance, onset in childhood or early adulthood (usually before 25 years of age), a primary defect in insulin secretion and frequent insulin-independence at the beginning of the disease.
    Defects in HNF1A are the cause of susceptibility to diabetes mellitus insulin-dependent type 20 (IDDM20) [MIM:612520]. IDDM20 is a multifactorial disorder of glucose homeostasis that is characterized by susceptibility to ketoacidosis in the absence of insulin therapy. Clinical fetaures are polydipsia, polyphagia and polyuria which result from hyperglycemia-induced osmotic diuresis and secondary thirst. These features can result in long-term complications that affect the eyes, kidneys, nerves, and blood vessels.
  • Sequence similarities

    Belongs to the HNF1 homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Albumin proximal factor antibody
    • Hepatic nuclear factor 1 alpha antibody
    • Hepatic nuclear factor 1 antibody
    • Hepatic transcription factor 1 alpha antibody
    • Hepatic transcription factor 1 antibody
    • Hepatocyte nuclear factor 1-alpha antibody
    • HNF 1 antibody
    • HNF 1A antibody
    • HNF-1-alpha antibody
    • HNF-1A antibody
    • hnf1a antibody
    • HNF1A_HUMAN antibody
    • Interferon production regulator factor antibody
    • LF B1 antibody
    • LF B1 hepatic nuclear factor antibody
    • LFB 1 antibody
    • LFB1 antibody
    • LFB1 hepatic nuclear factor antibody
    • Liver specific transcription factor LF B1 antibody
    • Liver specific transcription factor LFB1 antibody
    • Liver-specific transcription factor LF-B1 antibody
    • Maturity onset diabetes of the young 3 antibody
    • MODY 3 antibody
    • MODY3 antibody
    • TCF 1 antibody
    • TCF-1 antibody
    • TCF1 antibody
    • Transcription factor 1 antibody
    • Transcription factor 1 hepatic antibody
    see all

Images

  • All lanes : Anti-HNF1 alpha antibody (ab204306) at 1/100 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate
    Lane 3 : Human plasma
    Lane 4 : Human liver tissue lysate

    Developed using the ECL technique.

    Predicted band size: 67 kDa

  • Immunohistochemical analysis of paraffin-embedded Human small intestine tissue labeling HNF1 with ab204306 at a 1/200 dilution.

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized CACO-2 cells labeling HNF1 with ab204306 at 4 µg/mL (green).

References

This product has been referenced in:

  • Yu Y  et al. HNF1A/CASC2 regulates pancreatic cancer cell proliferation through PTEN/Akt signaling. J Cell Biochem 120:2816-2827 (2019). Read more (PubMed: 28865121) »
  • Liang L  et al. Validation of a multi-omics strategy for prioritizing personalized candidate driver genes Oncotarget 7:38440-38450 (2016). Read more (PubMed: 27469031) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204306.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up