Overview

  • Product name

  • Description

    Rabbit polyclonal to hnRNP A2B1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Orangutan
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human hnRNP A2B1 aa 21-103. (Expressed in E.coli).
    Sequence:

    RKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFS SMAEVDAAMAARPHSIDGRVVEPKRAVAREESG


    Database link: P22626

  • Positive control

    • IHC-P: Human rectum, liver cancer, stomach, esophagus cancer and kidney cancer tissues. WB: A549, Jurkat and K562 cell lysates; Recombinant human hnRNP A2B1 protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab232872 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232872 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 1 - 5 µg/ml. Predicted molecular weight: 37 kDa.

Target

  • Function

    Involved with pre-mRNA processing. Forms complexes (ribonucleosomes) with at least 20 other different hnRNP and heterogeneous nuclear RNA in the nucleous.
  • Sequence similarities

    Contains 2 RRM (RNA recognition motif) domains.
  • Cellular localization

    Nucleus > nucleoplasm. Cytoplasm. Localized in cytoplasmic mRNP granules containing untranslated mRNAs. Component of ribonucleosomes. Predominantly nucleoplasmic, however isoform A2 is also found in the cytoplasm of cells in some tissues. Not found in the nucleolus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Heterogeneous nuclear ribonucleoprotein A2 antibody
    • Heterogeneous nuclear ribonucleoprotein A2/B1 antibody
    • Heterogeneous nuclear ribonucleoprotein B1 antibody
    • Heterogeneous nuclear ribonucleoproteins A2/B1 antibody
    • hnRNP A2 / hnRNP B1 antibody
    • hnRNP A2 antibody
    • hnRNP A2/B1 antibody
    • hnRNP B1 antibody
    • hnRNP-A2 antibody
    • hnRNP-B1 antibody
    • hnRNPA2 antibody
    • Hnrnpa2b1 antibody
    • hnRNPB1 antibody
    • HNRPA2 antibody
    • HNRPA2B1 antibody
    • HNRPB1 antibody
    • Nuclear ribonucleoprotein particle A2 protein antibody
    • RNP A2 antibody
    • RNP B1 antibody
    • RNP-A2 antibody
    • RNP-B1 antibody
    • RNPA2 antibody
    • RNPB1 antibody
    • ROA2_HUMAN antibody
    • SNRPB1 antibody
    see all

Images

  • Paraffin-embedded human rectum tissue stained for hnRNP A2B1 using ab232872 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human liver cancer tissue stained for hnRNP A2B1 using ab232872 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human stomach tissue stained for hnRNP A2B1 using ab232872 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human esophagus cancer tissue stained for hnRNP A2B1 using ab232872 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human kidney cancer tissue stained for hnRNP A2B1 using ab232872 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-hnRNP A2B1 antibody (ab232872) at 5 µg/ml + Recombinant human hnRNP A2B1 protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 37 kDa

  • All lanes : Anti-hnRNP A2B1 antibody (ab232872) at 5 µg/ml

    Lane 1 : A549 (human lung carcinoma cell line) cell lysate
    Lane 2 : Jurkat (human T cell leukemia cell line from peripheral blood) cell lysate
    Lane 3 : K562 (human chronic myelogenous leukemia cell line from bone marrow) cell lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 37 kDa

References

ab232872 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232872.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up