Overview

  • Product name

  • Description

    Rabbit polyclonal to hnRNP Q
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide within Human hnRNP Q aa 236-285. The exact sequence is proprietary. (NP_006363.4).
    Sequence:

    VCISVANNRLFVGSIPKSKTKEQILEEFSKVTEGLTDVILYHQPDDKKKN


    Database link: O60506

  • Positive control

    • Human brain, neurons, tissue; HepG2 cells; HUVEC, Jurjkat and 293 cell extracts.

Properties

Applications

Our Abpromise guarantee covers the use of ab189405 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 20 µg/ml.
ICC/IF 1/100 - 1/500.
WB 1/500 - 1/1000. Predicted molecular weight: 70 kDa.

Target

  • Function

    Heterogenous nuclear ribonucleoprotein (hnRNP) implicated in mRNA processing mechanisms. Component of the CRD-mediated complex that promotes MYC mRNA stability. Isoform 1, isoform 2 and isoform 3 are associated in vitro with pre-mRNA, splicing intermediates and mature mRNA protein complexes. Isoform 1 binds to apoB mRNA AU-rich sequences. Isoform 1 is part of the APOB mRNA editosome complex and may modulate the postranscriptional C to U RNA-editing of the APOB mRNA through either by binding to A1CF (APOBEC1 complementation factor), to APOBEC1 or to RNA itself. May be involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. Interacts in vitro preferentially with poly(A) and poly(U) RNA sequences. Isoform 3 may be involved in cytoplasmic vesicle-based mRNA transport through interaction with synaptotagmins.
  • Tissue specificity

    Ubiquitously expressed. Detected in heart, brain, pancreas, placenta, spleen, lung, liver, skeletal muscle, kidney, thymus, prostate, uterus, small intestine, colon, peripheral blood and testis.
  • Sequence similarities

    Contains 3 RRM (RNA recognition motif) domains.
  • Domain

    The domain containing eight Arg-Gly-Gly repeats may be involved in RNA-binding and protein-protein interactions.
  • Post-translational
    modifications

    Phosphorylated on tyrosine. The membrane-bound form found in microsomes is phosphorylated in vitro by insulin receptor tyrosine kinase (INSR). Phosphorylation is inhibited upon binding to RNA, whereas the cytoplasmic form is poorly phosphorylated (By similarity). Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus > nucleoplasm. Expressed predominantly in the nucleoplasm and Cytoplasm. Microsome. Endoplasmic reticulum. Nucleus. The tyrosine phosphorylated form bound to RNA is found in microsomes (By similarity). Localized in cytoplasmic mRNP granules containing untranslated mRNAs.
  • Information by UniProt
  • Database links

  • Alternative names

    • cytoplasmic RNA-interacting protein antibody
    • dJ3J17.2 antibody
    • Glycine and tyrosine rich RNA binding protein antibody
    • Glycine- and tyrosine-rich RNA-binding protein antibody
    • GRY RBP antibody
    • GRY-RBP antibody
    • GRYRBP antibody
    • Heterogeneous nuclear ribonucleoprotein Q antibody
    • hnRNP Q antibody
    • HNRPQ antibody
    • HNRPQ_HUMAN antibody
    • HNRPQ1 antibody
    • NS1 associated protein 1 antibody
    • NS1-associated protein 1 antibody
    • NSAP1 antibody
    • pp68 antibody
    • RP1 3J17.2 antibody
    • Synaptotagmin binding cytoplasmic RNA interacting protein antibody
    • Synaptotagmin-binding antibody
    • Syncrip antibody
    see all

Images

  • All lanes : Anti-hnRNP Q antibody (ab189405) at 1/500 dilution

    Lane 1 : HUVEC cell extract
    Lane 2 : Jurkat cell extract
    Lane 3 : 293 cell extract
    Lane 4 : 293 cell extract with immunizing peptide

    Predicted band size: 70 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human brain, neurons, tissue labeling hnRNP Q with ab189405 at 20 µg/ml.

  • Immunofluorescent analysis of HepG2 cells labeling hnRNP Q with ab189405 at 1/100 dilution, in the presence (right panel) or absence (left panel) of immunizing peptide.

References

This product has been referenced in:

  • Lai MC  et al. Haplotype-specific MAPT exon 3 expression regulated by common intronic polymorphisms associated with Parkinsonian disorders. Mol Neurodegener 12:79 (2017). Read more (PubMed: 29084565) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab189405.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up