Overview

  • Product name

  • Description

    Rabbit polyclonal to HNRNPUL2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human HNRNPUL2 aa 183-282.
    Sequence:

    QDSEKSKPAGSDGERRGVKRQRDEKDEHGRAYYEFREEAYHSRSKSPLPP EEEAKDEEEDQTLVNLDTYTSDLHFQVSKDRYGGQPLFSEKFPTLWSGAR


    Database link: Q1KMD3

  • Positive control

    • MCF7 cells

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab220849 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Sequence similarities

    Contains 1 B30.2/SPRY domain.
    Contains 1 SAP domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZp762N1910 antibody
    • Heterogeneous nuclear ribonucleoprotein U like 2 antibody
    • Heterogeneous nuclear ribonucleoprotein U like protein 2 antibody
    • Heterogeneous nuclear ribonucleoprotein U-like protein 2 antibody
    • HNRL2_HUMAN antibody
    • HNRNPUL 2 antibody
    • HNRNPUL2 antibody
    • HNRPUL2 antibody
    • OTTHUMP00000236813 antibody
    • SAF A2 antibody
    • SAF-A2 antibody
    • Scaffold attachment factor A2 antibody
    • Scaffold-attachment factor A2 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized MCF7 cells labeling HNRNPUL2 with ab220849 at 4 µg/mL (green).

References

ab220849 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220849.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up