Overview

  • Product name

    Anti-HNRPH2/HNRNPH2 antibody
    See all HNRPH2/HNRNPH2 primary antibodies
  • Description

    Rabbit polyclonal to HNRPH2/HNRNPH2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human HNRPH2/HNRNPH2 aa 324-438 (C terminal).
    Sequence:

    DGRVTGEADVEFATHEDAVAAMAKDKANMQHRYVELFLNSTAGTSGGAYD HSYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGYGGG YGGQSSMSGYDQVLQ


    Database link: P55795

  • Positive control

    • WB: RT-4, HeLa and U-251 MG cell lysates; human liver and tonsil lysates. ICC/IF: U-251 MG cell line.
  • General notes

     This product was previously labelled as HNRPH2

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab219845 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

WB 1/100 - 1/250. Predicted molecular weight: 49 kDa.

Target

  • Function

    This protein is a component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complexes which provide the substrate for the processing events that pre-mRNAs undergo before becoming functional, translatable mRNAs in the cytoplasm. Binds poly(RG).
  • Tissue specificity

    Expressed ubiquitously.
  • Sequence similarities

    Contains 3 RRM (RNA recognition motif) domains.
  • Cellular localization

    Nucleus > nucleoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • FTP 3 antibody
    • FTP-3 antibody
    • FTP3 antibody
    • Heterogeneous nuclear ribonucleoprotein H'' antibody
    • heterogeneous nuclear ribonucleoprotein H2 (H') antibody
    • Heterogeneous nuclear ribonucleoprotein H2 antibody
    • HNRH2_HUMAN antibody
    • hnRNP H'' antibody
    • hnRNP H2 antibody
    • hnRNPH' antibody
    • HNRNPH2 antibody
    • HNRPH' antibody
    • HNRPH2 antibody
    see all

Images

  • Anti-HNRPH2/HNRNPH2 antibody (ab219845) at 0.4 µg/ml + HeLa whole cell lysate

    Predicted band size: 49 kDa

  • Immunofluorescent analysis of formalin fixed, triton X-100 permeabilized U-251 MG cells labeling HNRPH2/HNRNPH2 using ab219845 at 4 μg/mL (green).

  • All lanes : Anti-HNRPH2/HNRNPH2 antibody (ab219845) at 1/100 dilution

    Lane 1 : RT-4 MG cell lysate
    Lane 2 : U-251 MG cell lysate
    Lane 3 : Human plasma lysate
    Lane 4 : Human liver lysate
    Lane 5 : Human tonsil lysate

    Predicted band size: 49 kDa

References

ab219845 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219845.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up