Overview

  • Product name

    Anti-HNRPH3 antibody
  • Description

    Rabbit polyclonal to HNRPH3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ELISAmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human HNRPH3 aa 51-100 (N terminal).
    Sequence:

    DYQGRSTGEAFVQFASKEIAENALGKHKERIGHRYIEIFRSSRSEIKGFY

  • Positive control

    • Raji cell lysate. Human kidney tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab66663 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 37 kDa (predicted molecular weight: 37 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use a concentration of 4 - 8 µg/ml.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/62500.

Target

  • Relevance

    HNRPH3 belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • 2H9 antibody
    • FLJ34092 antibody
    • Heterogeneous nuclear ribonucleoprotein H3 antibody
    • hnRNP 2H9 antibody
    • hnRNP H3 antibody
    • HNRNPH 3 antibody
    • HNRNPH3 antibody
    • HNRPH 3 antibody
    see all

Images

  • All lanes : Anti-HNRPH3 antibody (ab66663) at 1 µg/ml

    Lane 1 : Marker
    Lane 2 : Raji cell lysate at 10 µg

    Secondary
    All lanes : HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 37 kDa
    Observed band size: 37 kDa
    Additional bands at: 17 kDa, 35 kDa (possible isoform). We are unsure as to the identity of these extra bands.



    Gel concentration: 12%
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human kidney tissue labelling HNRPH3 with ab66663 at 4-8µg/ml. Arrows indicate positively labelled epithelial cells of the renal tubule. Magnifciation: 400X.

References

ab66663 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
CLIP
Sample
Human Cell lysate - whole cell (HEK 293T)
Specification
HEK 293T
Type
iCLIP
Irradiation Energy Level (mJ/cm2): 150
Wavelength (nm): 254
Positive control
hnRNP C (sc-15386) bound protein A dynabeads, 0.1 mg/ml (antibody/beads)
Negative control
Protein A dynabeads without antibody bound
Immuno-precipitation step
Other - Protein A Dynabeads

Abcam user community

Verified customer

Submitted Jun 02 2011

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up