Anti-Homeobox protein cut-like 1 antibody [CL5275] (ab242194)
Key features and details
- Mouse monoclonal [CL5275] to Homeobox protein cut-like 1
- Suitable for: IHC-P, ICC/IF
- Reacts with: Mouse, Human
- Isotype: IgG2b
Overview
-
Product name
Anti-Homeobox protein cut-like 1 antibody [CL5275]
See all Homeobox protein cut-like 1 primary antibodies -
Description
Mouse monoclonal [CL5275] to Homeobox protein cut-like 1 -
Host species
Mouse -
Tested applications
Suitable for: IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Recombinant fragment corresponding to Human Homeobox protein cut-like 1 aa 724-826.
Sequence:LDPALKQAPLSQSDITILTPKLLSTSPMPTVSSYPPLAISLKKPSAAPEA GASALPNPPALKKEAQDAPGLDPQGAADCAQGVLRQVKNEVGRSGAWKDH WWS
Database link: P39880 -
Positive control
- IHC-P: Human cerebellum, endometrium and cervix tissue. ICC/IF: SH-SY5Y cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Protein A purified -
Purification notes
Purified from TCS. -
Clonality
Monoclonal -
Clone number
CL5275 -
Isotype
IgG2b -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab242194 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
ICC/IF | Use a concentration of 2 - 10 µg/ml. |
Target
-
Relevance
Function: Probably has a broad role in mammalian development as a repressor of developmentally regulated gene expression. May act by preventing binding of positively-activing CCAAT factors to promoters. Component of nf-munr repressor; binds to the matrix attachment regions (MARs) (5' and 3') of the immunoglobulin heavy chain enhancer. Represses T-cell receptor (TCR) beta enhancer function by binding to MARbeta, an ATC-rich DNA sequence located upstream of the TCR beta enhancer. Binds to the TH enhancer; may require the basic helix-loop-helix protein TCF4 as a coactivator (By similarity). Similarity: Belongs to the CUT homeobox family. -
Cellular localization
Nucleus -
Database links
- Entrez Gene: 1523 Human
- Omim: 116896 Human
- SwissProt: P39880 Human
- SwissProt: P70403 Mouse
- Unigene: 191482 Human
- Unigene: 320317 Mouse
-
Alternative names
- CCAAT displacement protein antibody
- CDP antibody
- CDP/Cut antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Homeobox protein cut-like 1 antibody [CL5275] (ab242194)
Paraffin-embedded human cervix tissue stained for Homeobox protein cut-like 1 using ab242194 at 1/1000 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Homeobox protein cut-like 1 antibody [CL5275] (ab242194)
Paraffin-embedded human endometrium tissue stained for Homeobox protein cut-like 1 using ab242194 at 1/1000 dilution in immunohistochemical analysis.
-
Immunocytochemistry/ Immunofluorescence - Anti-Homeobox protein cut-like 1 antibody [CL5275] (ab242194)
Paraformaldehyde-fixed, X-Triton-100 permeabilized SH-SY5Y (human neuroblastoma cell line from bone marrow) cells labeling Homeobox protein cut-like 1 (Green) using ab242194 at 4 µg/ml dilution in ICC/IF analysis. Microtubule probe visualized in red.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Homeobox protein cut-like 1 antibody [CL5275] (ab242194)
Paraffin-embedded human cerebellum tissue stained for Homeobox protein cut-like 1 using ab242194 at 1/1000 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab242194 has not yet been referenced specifically in any publications.