Anti-Homeobox protein cut-like 1 antibody [CL5275] (ab242194)

Submit a review Submit a question
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Homeobox protein cut-like 1 antibody [CL5275] (ab242194)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Homeobox protein cut-like 1 antibody [CL5275] (ab242194)
  • Immunocytochemistry/ Immunofluorescence - Anti-Homeobox protein cut-like 1 antibody [CL5275] (ab242194)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Homeobox protein cut-like 1 antibody [CL5275] (ab242194)

Key features and details

  • Mouse monoclonal [CL5275] to Homeobox protein cut-like 1
  • Suitable for: IHC-P, ICC/IF
  • Reacts with: Mouse, Human
  • Isotype: IgG2b

Overview

  • Product name

    Anti-Homeobox protein cut-like 1 antibody [CL5275]
    See all Homeobox protein cut-like 1 primary antibodies

  • Description

    Mouse monoclonal [CL5275] to Homeobox protein cut-like 1

  • Host species

    Mouse

  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details

  • Species reactivity

    Reacts with: Mouse, Human

  • Immunogen

    Recombinant fragment corresponding to Human Homeobox protein cut-like 1 aa 724-826.
    Sequence:

    LDPALKQAPLSQSDITILTPKLLSTSPMPTVSSYPPLAISLKKPSAAPEA GASALPNPPALKKEAQDAPGLDPQGAADCAQGVLRQVKNEVGRSGAWKDH WWS


    Database link: P39880
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • IHC-P: Human cerebellum, endometrium and cervix tissue. ICC/IF: SH-SY5Y cells.

  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

Applications

Our Abpromise guarantee covers the use of ab242194 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 2 - 10 µg/ml.

Target

  • Relevance

    Function: Probably has a broad role in mammalian development as a repressor of developmentally regulated gene expression. May act by preventing binding of positively-activing CCAAT factors to promoters. Component of nf-munr repressor; binds to the matrix attachment regions (MARs) (5' and 3') of the immunoglobulin heavy chain enhancer. Represses T-cell receptor (TCR) beta enhancer function by binding to MARbeta, an ATC-rich DNA sequence located upstream of the TCR beta enhancer. Binds to the TH enhancer; may require the basic helix-loop-helix protein TCF4 as a coactivator (By similarity). Similarity: Belongs to the CUT homeobox family.

  • Cellular localization

    Nucleus

  • Database links

    • Alternative names

      • CCAAT displacement protein antibody
      • CDP antibody
      • CDP/Cut antibody
      • CDP1 antibody
      • Clox antibody
      • COY1 antibody
      • Cut homeobox antibody
      • Cut homolog antibody
      • Cut like 1 antibody
      • Cut like homeobox 1 antibody
      • CUTL1 antibody
      • CUX antibody
      • Cux/CDP antibody
      • CUX1 antibody
      • Golgi integral membrane protein 6 antibody
      • GOLIM6 antibody
      • Homeobox protein cux 1 antibody
      • Nbla10317 antibody
      • p100 antibody
      • p110 antibody
      • p200 antibody
      • p75 antibody
      • Putative protein product of Nbla10317 antibody
      see all

    Images

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Homeobox protein cut-like 1 antibody [CL5275] (ab242194)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Homeobox protein cut-like 1 antibody [CL5275] (ab242194)

      Paraffin-embedded human cervix tissue stained for Homeobox protein cut-like 1 using ab242194 at 1/1000 dilution in immunohistochemical analysis.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Homeobox protein cut-like 1 antibody [CL5275] (ab242194)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Homeobox protein cut-like 1 antibody [CL5275] (ab242194)

      Paraffin-embedded human endometrium tissue stained for Homeobox protein cut-like 1 using ab242194 at 1/1000 dilution in immunohistochemical analysis.

    • Immunocytochemistry/ Immunofluorescence - Anti-Homeobox protein cut-like 1 antibody [CL5275] (ab242194)
      Immunocytochemistry/ Immunofluorescence - Anti-Homeobox protein cut-like 1 antibody [CL5275] (ab242194)

      Paraformaldehyde-fixed, X-Triton-100 permeabilized SH-SY5Y (human neuroblastoma cell line from bone marrow) cells labeling Homeobox protein cut-like 1 (Green) using ab242194 at 4 µg/ml dilution in ICC/IF analysis. Microtubule probe visualized in red.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Homeobox protein cut-like 1 antibody [CL5275] (ab242194)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Homeobox protein cut-like 1 antibody [CL5275] (ab242194)

      Paraffin-embedded human cerebellum tissue stained for Homeobox protein cut-like 1 using ab242194 at 1/1000 dilution in immunohistochemical analysis.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    References (0)

    Publishing research using ab242194? Please let us know so that we can cite the reference in this datasheet.

    ab242194 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab242194.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com