Anti-Homeobox protein cut-like 1 antibody [CL5275] (ab242194)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-Homeobox protein cut-like 1 antibody [CL5275]
See all Homeobox protein cut-like 1 primary antibodies -
Description
Mouse monoclonal [CL5275] to Homeobox protein cut-like 1 -
Host species
Mouse -
Tested applications
Suitable for: IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Recombinant fragment corresponding to Human Homeobox protein cut-like 1 aa 724-826.
Sequence:LDPALKQAPLSQSDITILTPKLLSTSPMPTVSSYPPLAISLKKPSAAPEA GASALPNPPALKKEAQDAPGLDPQGAADCAQGVLRQVKNEVGRSGAWKDH WWS
Database link: P39880 -
Positive control
- IHC-P: Human cerebellum, endometrium and cervix tissue. ICC/IF: WM-115 and SH-SY5Y cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.2
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Protein A purified -
Purification notes
Purified from TCS. -
Clonality
Monoclonal -
Clone number
CL5275 -
Isotype
IgG2b -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab242194 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
| ICC/IF | Use a concentration of 1 - 4 µg/ml. |
Target
-
Relevance
Function: Probably has a broad role in mammalian development as a repressor of developmentally regulated gene expression. May act by preventing binding of positively-activing CCAAT factors to promoters. Component of nf-munr repressor; binds to the matrix attachment regions (MARs) (5' and 3') of the immunoglobulin heavy chain enhancer. Represses T-cell receptor (TCR) beta enhancer function by binding to MARbeta, an ATC-rich DNA sequence located upstream of the TCR beta enhancer. Binds to the TH enhancer; may require the basic helix-loop-helix protein TCF4 as a coactivator (By similarity). Similarity: Belongs to the CUT homeobox family. -
Cellular localization
Nucleus -
Database links
- Entrez Gene: 1523 Human
- Omim: 116896 Human
- SwissProt: P39880 Human
- SwissProt: P70403 Mouse
- Unigene: 191482 Human
- Unigene: 320317 Mouse
-
Alternative names
- CCAAT displacement protein antibody
- CDP antibody
- CDP/Cut antibody
see all
Images
-
![Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Homeobox protein cut-like 1 antibody [CL5275] (ab242194)](https://www.abcam.com/ps/products/242/ab242194/Images/ab242194-331254-anti-homeobox-protein-cut-like-1-antibody-cl5275-immunohistochemistry.jpg)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Homeobox protein cut-like 1 antibody [CL5275] (ab242194)Paraffin-embedded human cervix tissue stained for Homeobox protein cut-like 1 using ab242194 at 1/1000 dilution in immunohistochemical analysis.
-
![Immunocytochemistry/ Immunofluorescence - Anti-Homeobox protein cut-like 1 antibody [CL5275] (ab242194)](https://www.abcam.com/ps/products/242/ab242194/Images/ab242194-331258-anti-homeobox-protein-cut-like-1-antibody-cl5275-immunofluorescence.jpg)
Immunocytochemistry/ Immunofluorescence - Anti-Homeobox protein cut-like 1 antibody [CL5275] (ab242194)Paraformaldehyde-fixed, X-Triton-100 permeabilized WM-115 cells labeling Homeobox protein cut-like 1 (Green) using ab242194 at 4 µg/ml dilution in ICC/IF analysis. Microtubule probe visualized in red.
-
![Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Homeobox protein cut-like 1 antibody [CL5275] (ab242194)](https://www.abcam.com/ps/products/242/ab242194/Images/ab242194-331255-anti-homeobox-protein-cut-like-1-antibody-cl5275-immunohistochemistry.jpg)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Homeobox protein cut-like 1 antibody [CL5275] (ab242194)Paraffin-embedded human endometrium tissue stained for Homeobox protein cut-like 1 using ab242194 at 1/1000 dilution in immunohistochemical analysis.
-
![Immunocytochemistry/ Immunofluorescence - Anti-Homeobox protein cut-like 1 antibody [CL5275] (ab242194)](https://www.abcam.com/ps/products/242/ab242194/Images/ab242194-331257-anti-homeobox-protein-cut-like-1-antibody-cl5275-immunofluorescence.jpg)
Immunocytochemistry/ Immunofluorescence - Anti-Homeobox protein cut-like 1 antibody [CL5275] (ab242194)Paraformaldehyde-fixed, X-Triton-100 permeabilized SH-SY5Y (human neuroblastoma cell line from bone marrow) cells labeling Homeobox protein cut-like 1 (Green) using ab242194 at 4 µg/ml dilution in ICC/IF analysis. Microtubule probe visualized in red.
-
![Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Homeobox protein cut-like 1 antibody [CL5275] (ab242194)](https://www.abcam.com/ps/products/242/ab242194/Images/ab242194-331256-anti-homeobox-protein-cut-like-1-antibody-cl5275-immunohistochemistry.jpg)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Homeobox protein cut-like 1 antibody [CL5275] (ab242194)Paraffin-embedded human cerebellum tissue stained for Homeobox protein cut-like 1 using ab242194 at 1/1000 dilution in immunohistochemical analysis.
Datasheets and documents
References
ab242194 has not yet been referenced specifically in any publications.
