Overview

  • Product name

  • Description

    Mouse polyclonal to HOOK3
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Xenopus laevis
  • Immunogen

    Recombinant full length protein corresponding to Human HOOK3 aa 1-718. (NP_115786.1).
    Sequence:

    MFSVESLERAELCESLLTWIQTFNVDAPCQTVEDLTNGVVMAQVLQKIDP AYFDENWLNRIKTEVGDNWRLKISNLKKILKGILDYNHEILGQQINDFTL PDVNLIGEHSDAAELGRMLQLILGCAVNCEQKQEYIQAIMMMEESVQHVV MTAIQELMSKESPVSAGNDAYVDLDRQLKKTTEELNEALSAKEEIAQRCH ELDMQVAALQEEKSSLLAENQVLMERLNQSDSIEDPNSPAGRRHLQLQTQ LEQLQEETFRLEAAKDDYRIRCEELEKEISELRQQNDELTTLADEAQSLK DEIDVLRHSSDKVSKLEGQVESYKKKLEDLGDLRRQVKLLEEKNTMYMQN TVSLEEELRKANAARSQLETYKRQVVELQNRLSEESKKADKLDFEYKRLK EKVDSLQKEKDRLRTERDSLKETIEELRCVQAQEGQLTTQGLMPLGSQES SDSLAAEIVTPEIREKLIRLQHENKMLKLNQEGSDNEKIALLQSLLDDAN LRKNELETENRLVNQRLLEVQSQVEELQKSLQDQGSKAEDSVLLKKKLEE HLEKLHEANNELQKKRAIIEDLEPRFNNSSLKIEELQEALRKKEEEMKQM EERYKKYLEKAKSVIRTLDPKQNQGAAPEIQALKNQLQERDRLFHSLEKE YEKTKSQREMEEKYIVSAWYNMGMTLHKKAAEDRLASTGSGQSFLARQRQ ATSSRRSYPGHVQPATAR


    Database link: Q86VS8

  • Positive control

    • HOOK3 transfected 293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab173388 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 83 kDa.

Target

  • Function

    Probably serves as a target for the spiC protein from Salmonella typhimurium, which inactivates it, leading to a strong alteration in cellular trafficking (By similarity). Component of the FTS/Hook/FHIP complex (FHF complex). The FHF complex may function to promote vesicle trafficking and/or fusion via the homotypic vesicular protein sorting complex (the HOPS complex). May regulate clearance of endocytosed receptors such as MSR1. Participates in defining the architecture and localization of the Golgi complex.
  • Sequence similarities

    Belongs to the hook family.
  • Cellular localization

    Cytoplasm > cytoskeleton. Golgi apparatus. Enriched at the cis-face of the Golgi complex (By similarity). Localizes to microtubule asters in prophase.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ31058 antibody
    • h-hook3 antibody
    • hHK3 antibody
    • HK3 antibody
    • hook3 antibody
    • HOOK3_HUMAN antibody
    • OTTHUMP00000229200 antibody
    • Protein Hook homolog 3 antibody
    see all

Images

  • All lanes : Anti-HOOK3 antibody (ab173388) at 1 µg/ml

    Lane 1 : HOOK3 transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat anti-Mouse IgG at 1/2500 dilution

    Predicted band size: 83 kDa

References

ab173388 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173388.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up