Overview

  • Product name

  • Description

    Rabbit polyclonal to HOOK3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IP, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Xenopus laevis
  • Immunogen

    Recombinant fragment corresponding to Human HOOK3 aa 357-455.
    Sequence:

    ELRKANAARSQLETYKRQVVELQNRLSEESKKADKLDFEYKRLKEKVDSL QKEKDRLRTERDSLKETIEELRCVQAQEGQLTTQGLMPLGSQESSDSLA


    Database link: Q86VS8

  • Positive control

    • WB: HEK-293 whole cell lysate. IHC-P: Human colon cancer tissue. IP: HEK-293 whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab237529 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000.
IP 1/200 - 1/2000.
IHC-P 1/200 - 1/500.

Target

  • Function

    Probably serves as a target for the spiC protein from Salmonella typhimurium, which inactivates it, leading to a strong alteration in cellular trafficking (By similarity). Component of the FTS/Hook/FHIP complex (FHF complex). The FHF complex may function to promote vesicle trafficking and/or fusion via the homotypic vesicular protein sorting complex (the HOPS complex). May regulate clearance of endocytosed receptors such as MSR1. Participates in defining the architecture and localization of the Golgi complex.
  • Sequence similarities

    Belongs to the hook family.
  • Cellular localization

    Cytoplasm > cytoskeleton. Golgi apparatus. Enriched at the cis-face of the Golgi complex (By similarity). Localizes to microtubule asters in prophase.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ31058 antibody
    • h-hook3 antibody
    • hHK3 antibody
    • HK3 antibody
    • hook3 antibody
    • HOOK3_HUMAN antibody
    • OTTHUMP00000229200 antibody
    • Protein Hook homolog 3 antibody
    see all

Images

  • Paraffin-embedded human colon cancer tissue stained for HOOK3 with ab237529 at a 1/300 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • Anti-HOOK3 antibody (ab237529) at 1/500 dilution + HEK-293 (Human epithelial cell line from embryonic kidney) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution
  • HOOK3 was immunoprecipitated from HEK-293 (Human epithelial cell line from embryonic kidney) whole cell lysate using 6 µg of ab237529.

    Lane 1: Rabbit control IgG in HEK-293 whole cell lysate.

    Lane 2: ab237529 (6 µg) in HEK-293 whole cell lysate.

    Lane 3: HEK-293 whole cell lysate (20 µg input).

    For western blotting an HRP-conjugated Protein G antibody was used as the secondary antibody at a 1/2000 dilution.

References

ab237529 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237529.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up