Anti-HOPX/HOD antibody (ab106251)
Key features and details
- Rabbit polyclonal to HOPX/HOD
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-HOPX/HOD antibody
See all HOPX/HOD primary antibodies -
Description
Rabbit polyclonal to HOPX/HOD -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Cow, Pig -
Immunogen
Recombinant full length protein corresponding to Human HOPX/HOD aa 1-73. (BC014225)
Sequence:MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKW FKQRLAKWRRSEGLPSECRSVTD
-
Positive control
- Human fetal heart tissue lysate.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Lyophilized:Reconstitute with 200ul distilled sterile water. Please note that if you receive this product in liquid form it has already been reconstituted as described and no further reconstitution is necessary. -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 0.184% Tris glycine, 1% BSA -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab106251 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/500 - 1/1000. Detects a band of approximately 8 kDa (predicted molecular weight: 8 kDa).
|
Notes |
---|
WB
1/500 - 1/1000. Detects a band of approximately 8 kDa (predicted molecular weight: 8 kDa). |
Target
-
Function
Atypical homeodomain protein which does not bind DNA and is required to modulate cardiac growth and development. Acts via its interaction with SRF, thereby modulating the expression of SRF-dependent cardiac-specific genes and cardiac development. Prevents SRF-dependent transcription either by inhibiting SRF binding to DNA or by recruiting histone deacetylase (HDAC) proteins that prevent transcription by SRF. Overexpression causes cardiac hypertrophy (By similarity). May act as a tumor suppressor. -
Tissue specificity
Widely expressed. Expressed in the heart, brain, placenta, lung, skeletal and smooth muscles, uterus, urinary bladder, kidney and spleen. Down-regulated in some types of cancer such as lung cancer, choriocarcinoma, head and neck squamous cell carcinoma and oral squamous cell carcinoma. -
Sequence similarities
Contains 1 homeobox DNA-binding domain. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 281270 Cow
- Entrez Gene: 84525 Human
- Entrez Gene: 74318 Mouse
- Entrez Gene: 396692 Pig
- Entrez Gene: 171160 Rat
- Omim: 607275 Human
- SwissProt: Q8MJD5 Cow
- SwissProt: Q9BPY8 Human
see all -
Form
There are 2 isoforms produced by alternative splicing. -
Alternative names
- CAMEO antibody
- heart odd homeobox 1 protein antibody
- HOD antibody
see all
Images
Datasheets and documents
-
SDS download
-
Datasheet download
References (1)
ab106251 has been referenced in 1 publication.
- Sengupta A et al. A New Immortalized Human Alveolar Epithelial Cell Model to Study Lung Injury and Toxicity on a Breathing Lung-On-Chip System. Front Toxicol 4:840606 (2022). PubMed: 35832493