Overview

  • Product name

  • Description

    Rabbit polyclonal to HOPX/HOD
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Pig
  • Immunogen

    Recombinant full length protein corresponding to Human HOPX/HOD aa 1-73. (BC014225)
    Sequence:

    MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKW FKQRLAKWRRSEGLPSECRSVTD

  • Positive control

    • Human fetal heart tissue lysate.
  • General notes

     This product was previously labelled as HOPX

     

Properties

Applications

Our Abpromise guarantee covers the use of ab106251 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Detects a band of approximately 8 kDa (predicted molecular weight: 8 kDa).
IHC-P Use at an assay dependent concentration.

Target

  • Function

    Atypical homeodomain protein which does not bind DNA and is required to modulate cardiac growth and development. Acts via its interaction with SRF, thereby modulating the expression of SRF-dependent cardiac-specific genes and cardiac development. Prevents SRF-dependent transcription either by inhibiting SRF binding to DNA or by recruiting histone deacetylase (HDAC) proteins that prevent transcription by SRF. Overexpression causes cardiac hypertrophy (By similarity). May act as a tumor suppressor.
  • Tissue specificity

    Widely expressed. Expressed in the heart, brain, placenta, lung, skeletal and smooth muscles, uterus, urinary bladder, kidney and spleen. Down-regulated in some types of cancer such as lung cancer, choriocarcinoma, head and neck squamous cell carcinoma and oral squamous cell carcinoma.
  • Sequence similarities

    Contains 1 homeobox DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Form

    There are 2 isoforms produced by alternative splicing.
  • Alternative names

    • CAMEO antibody
    • heart odd homeobox 1 protein antibody
    • HOD antibody
    • Homeodomain-only protein antibody
    • HOP antibody
    • HOP homeobox antibody
    • HOP_HUMAN antibody
    • HOPX antibody
    • LAGY antibody
    • Lung cancer-associated Y protein antibody
    • NECC1 antibody
    • Not expressed in choriocarcinoma clone 1 antibody
    • Not expressed in choriocarcinoma protein 1 antibody
    • OB1 antibody
    • odd homeobox 1 protein antibody
    • Odd homeobox protein 1 antibody
    • OTTHUMP00000158970 antibody
    • SMAP31 antibody
    • TOTO antibody
    see all

Images

  • Anti-HOPX/HOD antibody (ab106251) at 1/500 dilution + Human fetal heart tissue lysate

    Predicted band size: 8 kDa

References

ab106251 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-6 of 6 Abreviews or Q&A

Application
Immunocytochemistry/ Immunofluorescence
Sample
Horse Cell (intestine)
Permeabilization
Yes - Reveal Decloaker RTU
Specification
intestine
Blocking step
Dako protein block as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 100% · Temperature: 24°C
Fixative
Paraformaldehyde

John Freund

Verified customer

Submitted Nov 28 2018

Application
Immunohistochemistry (Frozen sections)
Sample
Mouse Tissue sections (heart)
Specification
heart
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Sep 26 2018

Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (Human cerebral organoid)
Specification
Human cerebral organoid
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 4% · Temperature: 25°C
Fixative
Paraformaldehyde

Radhika Menon

Verified customer

Submitted Nov 30 2017

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (Mouse lung)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Sodium Citrate
Permeabilization
Yes - 0.5% TritonX 100
Specification
Mouse lung
Blocking step
BSA as blocking agent for 30 minute(s) · Concentration: 5% · Temperature: RT°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Aug 11 2017

Application
Immunohistochemistry (Frozen sections)
Sample
Mouse Tissue sections (Brain)
Permeabilization
Yes - Triton X-100
Specification
Brain
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: RT°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Jul 20 2016

Question
Answer

Thank you for your telephone enquiry this afternoon. I am sorry to hear you have experienced difficulty obtaining satisfactory results from this antibody in western blotting.The details provided enable us to closely monitor the quality of our products. I am sorry this product did not perform as stated on the datasheet and for the inconvenience this has caused. As requested, I have issued a free of charge replacement as well as a positive control lysate with the order number xxxxxx. This order should arrive late next week as we currently do not have the control lysate in our US stock and awaiting the products arrival.To check the status of the order please contact our Customer Service team and reference this number. Please note that this free of charge replacement vial is also covered by our Abpromise guarantee. Should you still be experiencing difficulties, or if you have any further questions, please do not hesitate to let us know. I wish you the best of luck with your research.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up