Overview

  • Product name

  • Description

    Rabbit polyclonal to HOXA2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human HOXA2 aa 26-124.
    Sequence:

    PPVADTFQSSSIKTSTLSHSTLIPPPFEQTIPSLNPGSHPRHGAGGRPKP SPAGSRGSPVPAGALQPPEYPWMKEKKAAKKTALLPAAAAAATAAATGP


    Database link: O43364

  • Positive control

    • IHC-P: Human liver cancer and tonsil tissues. WB: Jurkat whole cell lysate; Mouse liver, kidney and stomach lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity > 95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab229960 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/2000 - 1/5000. Detects a band of approximately 42 kDa (predicted molecular weight: 41 kDa).

Target

  • Function

    Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
  • Involvement in disease

    Defects in HOXA2 are a cause of microtia hearing impairment and cleft palate (MHICP) [MIM:612290]. Microtia is a congenital deformity of the outer ear and occurs in approximately one in 8'000-10'000 births. It is characterized by a small, abnormally shaped outer ear. It can be unilateral or bilateral. Syndromic forms of microtia occur in conjunction with other abnormalities. The most common associated malformations is the cleft palate, a congenital fissure of the soft and/or hard palate due to faulty fusion. Defects in HOXA2 are a cause of autosomal-recessive bilateral microtia, mixed symmetrical severe to profound hearing impairment and partial cleft palate.
  • Sequence similarities

    Belongs to the Antp homeobox family. Proboscipedia subfamily.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • AI324701 antibody
    • homeo box A2 antibody
    • homeobox A2 antibody
    • Homeobox protein Hox-1K antibody
    • Homeobox protein Hox-A2 antibody
    • Hox-1.11 antibody
    • HOX1.11 antibody
    • HOX1K antibody
    • Hoxa-2 antibody
    • Hoxa11 antibody
    • HOXA2 antibody
    • HXA2_HUMAN antibody
    • MGC151482 antibody
    • MGC151484 antibody
    • RATHOX111A antibody
    see all

Images

  • Paraffin-embedded human liver cancer tissue stained for HOXA2 using ab229960 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human tonsil tissue stained for HOXA2 using ab229960 at 1/100 dilution in immunohistochemical analysis.

  • All lanes : Anti-HOXA2 antibody (ab229960) at 1/2000 dilution

    Lane 1 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 2 : Mouse liver lysate
    Lane 3 : Mouse kidney lysate
    Lane 4 : Mouse stomach lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 41 kDa
    Observed band size: 42 kDa
    why is the actual band size different from the predicted?

References

ab229960 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunohistochemistry (Frozen sections)
Sample
Human Tissue sections (whole head)
Permeabilization
Yes - 0.05% tween20
Specification
whole head
Blocking step
Serum as blocking agent for 2 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: RT°C
Fixative
Formaldehyde

Dr. Juan Fons

Verified customer

Submitted Mar 27 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up