Overview

  • Product name

  • Description

    Rabbit polyclonal to HOXA7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Synthetic peptide corresponding to Rat HOXA7 aa 1-30 (N terminal) conjugated to Keyhole Limpet Haemocyanin (KLH).
    Sequence:

    LGPDGKRGRQTYTRYQTLELEKEFHFNRYL


    Database link: P09634

  • Positive control

    • WiDr whole cell lysate, Human skin tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab211521 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 µg/ml. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.
WB 1/1000.

Target

  • Function

    Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
  • Sequence similarities

    Belongs to the Antp homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • ANTP antibody
    • Antp, Drosophila, homolog of antibody
    • Homeobox 1A antibody
    • Homeobox A7 antibody
    • Homeobox protein Hox 1.1 antibody
    • Homeobox protein Hox A7 antibody
    • Homeobox protein Hox-1A antibody
    • Homeobox protein Hox-A7 antibody
    • HOX1 antibody
    • HOX1.1 antibody
    • HOX1.1, mouse, homolog of antibody
    • Hox1A antibody
    • HOXA7 antibody
    • HXA7_HUMAN antibody
    • OTTHUMP00000024835 antibody
    see all

Images

  • Immunohistochemical analysis of Human skin tissue labeling HOXA7 with ab211521 at 5 μg/ml. Heat mediated antigen retrieval used.

  • Anti-HOXA7 antibody (ab211521) at 1/1000 dilution + WiDr whole cell lysate at 35 µg

References

This product has been referenced in:

  • Bertolini I  et al. A GBM-like V-ATPase signature directs cell-cell tumor signaling and reprogramming via large oncosomes. EBioMedicine N/A:N/A (2019). Read more (PubMed: 30737083) »
  • Terrasi A  et al. Specific V-ATPase expression sub-classifies IDHwt lower-grade gliomas and impacts glioma growth in vivo. EBioMedicine N/A:N/A (2019). Read more (PubMed: 30737087) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab211521.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up