
  • Product name

  • Description

    Rabbit polyclonal to HOXC4
  • Host species

  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Dog, Zebrafish
  • Immunogen

    A 14-22 amino acid region within synthetic peptide: MIMSSYLMDS NYIDPKFPPC EEYSQNSYIP EHSPEYYGRT RESGFQHHHQ, corresponding to amino acids 1-50 of Human HOXC4

  • Positive control

    • Fetal liver lysate.



Our Abpromise guarantee covers the use of ab24338 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 2 µg/ml. Detects a band of approximately 30 kDa (predicted molecular weight: 30 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.



  • Anti-HOXC4 antibody (ab24338) at 2 µg/ml + Human fetal liver lysate.

    HRP-conjugated anti-Rabbit IgG at 1/50000 - 1/100000 dilution

    Predicted band size: 30 kDa
    Observed band size: 30 kDa

    ab24338 is diluted in 5% skim milk / PBS buffer. Gel concentration: 12%


ab24338 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A


Thank you for your enquiry. I have been in touch with the source of this antibody and I can tell you that the immunogen sequence used to raise ab24338 was: MIMSSYLMDSNYIDPKFPPCEEYSQNSYIPEHSPEYYGRTRESGFQHHHQ I hope this information helps, please do not hesitate to contact us if you need any more advice or information.

Read More
Western blot
Human Tissue lysate - whole (prostate tumour)
Loading amount
15 µg
prostate tumour
Blocking step
BSA as blocking agent for 2 hour(s) and 0 minute(s) · Concentration: 4%

Dr. Richard Morgan

Verified customer

Submitted Mar 13 2006

For licensing inquiries, please contact partnerships@abcam.com

Sign up