Overview

  • Product name

  • Description

    Rabbit polyclonal to HOXC8
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human HOXC8 aa 1-242.
    Sequence:

    MSSYFVNPLFSKYKAGESLEPAYYDCRFPQSVGRSHALVYGPGGSAPGFQ HASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGDASKFYGYEALPRQSLY GAQQEASVVQYPDCKSSANTNSSEGQGHLNQNSSPSLMFPWMRPHAPGRR SGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNR RMKWKKENNKDKLPGARDEEKVEEEGNEEEEKEEEEKEENKD


    Database link: P31273

Properties

Applications

Our Abpromise guarantee covers the use of ab192544 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 28 kDa.
IHC-P Use at an assay dependent concentration.

Target

  • Function

    Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
  • Sequence similarities

    Belongs to the Antp homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Homeo box 3A antibody
    • Homeo box 8 antibody
    • Homeobox 3A antibody
    • Homeobox C8 antibody
    • Homeobox protein Hox C8 antibody
    • Homeobox protein Hox-3A antibody
    • Homeobox protein Hox-C8 antibody
    • Homeobox protein HoxC8 antibody
    • Homeobox protein R4 antibody
    • Homolog of mouse Hox 3.1 antibody
    • HOX 3 antibody
    • Hox 3.1 mouse homolog of antibody
    • HOX 3A antibody
    • HOX C8 antibody
    • Hox-3.1 antibody
    • Hox-3A antibody
    • HOX3 antibody
    • HOX3A antibody
    • HOXC 8 antibody
    • Hoxc-8 antibody
    • HOXC8 antibody
    • HXC8_HUMAN antibody
    • M31 antibody
    see all

References

ab192544 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192544.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up