Overview

  • Product name

  • Description

    Rabbit polyclonal to HOXD1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human HOXD1 aa 287-328.
    Sequence:

    REREGLLATAIPVAPLQLPLSGTTPTKFIKNPGSPSQSQEPS


    Database link: Q9GZZ0

  • Positive control

    • RT-4 cells; Human plasma.

Properties

Applications

Our Abpromise guarantee covers the use of ab220856 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/100 - 1/250. Predicted molecular weight: 34 kDa.

Target

  • Function

    Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Acts on the anterior body structures.
  • Sequence similarities

    Belongs to the Antp homeobox family. Labial subfamily.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • homeo box 4G antibody
    • homeo box D1 antibody
    • Homeobox protein Hox D1 antibody
    • Homeobox protein Hox-D1 antibody
    • Homeobox protein Hox-GG antibody
    • HOX 4 antibody
    • HOX 4G antibody
    • HOX D1 antibody
    • Hox-4.7 antibody
    • HOX4 antibody
    • Hox4.9 antibody
    • HOX4G antibody
    • hoxd1 antibody
    • HXD1_HUMAN antibody
    • OTTHUMP00000163336 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized RT-4 cells labeling HOXD1 with ab220856 at 4 μg/ml (green).

  • All lanes : Anti-HOXD1 antibody (ab220856) at 1/100 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate
    Lane 3 : Human plasma

    Predicted band size: 34 kDa

References

ab220856 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220856.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up