Overview

  • Product name

  • Description

    Rabbit polyclonal to HOXD1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human HOXD1 aa 59-131.
    Sequence:

    ARPSPSPPAAPARPSVPPPAAPQYAQCTLEGAYEPGAAPAAAAGGADYGF LGSGPAYDFPGVLGRAADDGGSH


    Database link: Q9GZZ0

  • Positive control

    • WB: Rat lung and kidney lysate; Mouse lung lysate. IHC-P: Human brain tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235103 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000.
WB 1/500 - 1/5000.

Target

  • Function

    Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Acts on the anterior body structures.
  • Sequence similarities

    Belongs to the Antp homeobox family. Labial subfamily.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • homeo box 4G antibody
    • homeo box D1 antibody
    • Homeobox protein Hox D1 antibody
    • Homeobox protein Hox-D1 antibody
    • Homeobox protein Hox-GG antibody
    • HOX 4 antibody
    • HOX 4G antibody
    • HOX D1 antibody
    • Hox-4.7 antibody
    • HOX4 antibody
    • Hox4.9 antibody
    • HOX4G antibody
    • hoxd1 antibody
    • HXD1_HUMAN antibody
    • OTTHUMP00000163336 antibody
    see all

Images

  • All lanes : Anti-HOXD1 antibody (ab235103) at 1/500 dilution

    Lane 1 : Rat lung lysate
    Lane 2 : Rat kidney lysate
    Lane 3 : Mouse lung lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution
  • Paraffin-embedded human brain tissue stained for HOXD1 using ab235103 at 1/600 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at room temperature. Primary antibody (1% BSA) was incubated at 4°C overnight. The primary antibody was detected by a biotinylated secondary antibody and visualized using a HRP conjugated SP system.

References

ab235103 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235103.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up