Overview

  • Product name

  • Description

    Rabbit polyclonal to HOXD1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ELISAmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide within Human HOXD1 aa 254-303 (C terminal). The exact sequence is proprietary.
    Sequence:

    LTRARRIEIANCLHLNDTQVKIWFQNRRMKQKKREREGLLATAIPVAPLQ


    Database link: Q9GZZ0

  • Positive control

    • Fetal liver lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab80305 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 34 kDa (predicted molecular weight: 34 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay 1/312500.

Target

  • Function

    Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Acts on the anterior body structures.
  • Sequence similarities

    Belongs to the Antp homeobox family. Labial subfamily.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • homeo box 4G antibody
    • homeo box D1 antibody
    • Homeobox protein Hox D1 antibody
    • Homeobox protein Hox-D1 antibody
    • Homeobox protein Hox-GG antibody
    • HOX 4 antibody
    • HOX 4G antibody
    • HOX D1 antibody
    • Hox-4.7 antibody
    • HOX4 antibody
    • Hox4.9 antibody
    • HOX4G antibody
    • hoxd1 antibody
    • HXD1_HUMAN antibody
    • OTTHUMP00000163336 antibody
    see all

Images

  • Anti-HOXD1 antibody (ab80305) at 1 µg/ml + fetal liver lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 34 kDa
    Observed band size: 34 kDa



    Gel concentration 12%

References

ab80305 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Answer

Thank you for your reply.

I'm sending a vial of ab68052 free of charge on the order ***. This antibody is on back orderand I expect it to arrive around April 6.

Please keep me updated about how this replacement antibody works for you, and let me know if you have any questions or if there is anything else that we can do for you.

Read More

Answer

Thank you for your call yesterday. It was a pleasure speaking to you, and thank you for sending the image.

The bands inthe imageare a little bit higher than I would have expected, however that could just be a difference in the electrophoresis conditions, but I am not sure. I am concerned that the bands were so weak even after loading 100 ug of protein onto the gel.

Based on this, I would be happy to send a different antibody to try. We also have ab98100 and ab68052 (linked below) or I can send another vial of ab80305.

https://www.abcam.com/HOXD1-antibody-ab98100.html

https://www.abcam.com/HOXD1-antibody-ab68052.html

Alternatively I can issue a credit or refund for your purchase. If you are interested in receiving a replacement, credit, or refund, pleaselet me knowand I can process that immediately.

I apologize for the trouble with this antibody, and I look forward to hearing from you. Please let me know if you have any questions or if there is anything else that we can do for you.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up