Anti-HP1 alpha + CBX1 / HP1 beta + HP1 gamma antibody (ab230723)
Key features and details
- Rabbit polyclonal to HP1 alpha + CBX1 / HP1 beta + HP1 gamma
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-HP1 alpha + CBX1 / HP1 beta + HP1 gamma antibody -
Description
Rabbit polyclonal to HP1 alpha + CBX1 / HP1 beta + HP1 gamma -
Host species
Rabbit -
Specificity
ab230723 also recognizes the alpha and gamma isoforms. -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse -
Immunogen
Recombinant full length protein (GST-tag) corresponding to Human CBX1/ HP1 beta aa 1-185.
Sequence:MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDN TWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKP KKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAK EANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN
Database link: P83916 -
Positive control
- WB: HeLa nuclear extract.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide -
Concentration information loading...
-
Purity
Whole antiserum -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab230723 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/1000. Predicted molecular weight: 21 kDa. |
Target
-
Cellular localization
HP1 alpha: Nucleus. Chromosome. Chromosome > centromere. Component of centromeric and pericentromeric heterochromatin. Associates with chromosomes during mitosis. Associates specifically with chromatin during metaphase and anaphase. CBX1 / HP1 beta: Nucleus. Unassociated with chromosomes during mitosis. HP1 gamma: Nucleus. Associates with euchromatin and is largely excluded from constitutive heterochromatin. May be associated with microtubules and mitotic poles during mitosis. -
Database links
- Entrez Gene: 10951 Human
- Entrez Gene: 11335 Human
- Entrez Gene: 23468 Human
- Entrez Gene: 12412 Mouse
- Entrez Gene: 12417 Mouse
- Entrez Gene: 12419 Mouse
- Omim: 604477 Human
- Omim: 604478 Human
see all
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab230723 has not yet been referenced specifically in any publications.