Overview

  • Product name

    Anti-HP1 alpha antibody [3A11F8]
    See all HP1 alpha primary antibodies
  • Description

    Mouse monoclonal [3A11F8] to HP1 alpha
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, Flow Cyt, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human HP1 alpha aa 1-191. Expressed in E. coli.
    Sequence:

    MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNT WEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADD IKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADL VLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS


    Database link: P45973

  • Positive control

    • WB: HeLa, NIH/3T3, K562, MCF7, Jurkat and A431 cell lysate; Recombinant human HP1 alpha (amino acids: 1-191) protein; HP1 alpha (amino acids: 1-191)-hIgGFc transfected HEK-293 cell lysate. ICC/IF: HeLa cells. Flow Cytometry: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab234085 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/500. Predicted molecular weight: 22 kDa.
Flow Cyt 1/200 - 1/400.
ICC/IF 1/200 - 1/1000.

Target

  • Function

    Component of heterochromatin that recognizes and binds histone H3 tails methylated at 'Lys-9' (H3K9me), leading to epigenetic repression. In contrast, it is excluded from chromatin when 'Tyr-41' of histone H3 is phosphorylated (H3Y41ph). Can interact with lamin-B receptor (LBR). This interaction can contribute to the association of the heterochromatin with the inner nuclear membrane. Involved in the formation of functional kinetochore through interaction with MIS12 complex proteins.
  • Sequence similarities

    Contains 2 chromo domains.
  • Post-translational
    modifications

    Phosphorylation of HP1 and LBR may be responsible for some of the alterations in chromatin organization and nuclear structure which occur at various times during the cell cycle (By similarity). Phosphorylated during interphase and possibly hyper-phosphorylated during mitosis.
    Ubiquitinated.
  • Cellular localization

    Nucleus. Chromosome. Chromosome > centromere. Component of centromeric and pericentromeric heterochromatin. Associates with chromosomes during mitosis. Associates specifically with chromatin during metaphase and anaphase.
  • Information by UniProt
  • Database links

  • Alternative names

    • Antigen p25 antibody
    • CBX5 antibody
    • CBX5_HUMAN antibody
    • CG8409 antibody
    • Chromobox 5 antibody
    • Chromobox homolog 5 (HP1 alpha homolog, Drosophila) antibody
    • Chromobox homolog 5 antibody
    • Chromobox protein homolog 5 antibody
    • Epididymis luminal protein 25 antibody
    • HEL25 antibody
    • Heterochromatin protein 1 alpha antibody
    • Heterochromatin protein 1 antibody
    • Heterochromatin protein 1 homolog alpha antibody
    • HP1 alpha antibody
    • HP1 alpha homolog antibody
    • HP1 antibody
    • HP1A antibody
    • HP1Hs alpha antibody
    • Su(var)205 antibody
    see all

Images

  • All lanes : Anti-HP1 alpha antibody [3A11F8] (ab234085) at 1/100 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 2 : NIH/3T3 (mouse embryo fibroblast cell line) cell lysate
    Lane 3 : K562 (human chronic myelogenous leukemia cell line from bone marrow) cell lysate
    Lane 4 : MCF7 (human breast adenocarcinoma cell line) cell lysate
    Lane 5 : Jurkat (human T cell leukemia cell line from peripheral blood) cell lysate
    Lane 6 : A431 (human epidermoid carcinoma cell line) cell lysate

    Predicted band size: 22 kDa

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for HP1 alpha (green) using ab234085 at 1/200 dilution in ICC/IF.

    Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with AlexaFluor®555-Phalloidin. 

  • Flow Cytometry analysis of HeLa (human epithelial cell line from cervix adenocarcinoma) cells, labeling HP1 alpha with ab234085 at 1/200 dilution (green) compared to a negative control (red).

  • All lanes : Anti-HP1 alpha antibody [3A11F8] (ab234085) at 1/100 dilution

    Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) cell lysate
    Lane 2 : HP1 alpha (amino acids: 1-191)-hIgGFc transfected HEK-293 cell lysate

    Predicted band size: 22 kDa

  • Anti-HP1 alpha antibody [3A11F8] (ab234085) at 1/100 dilution + Recombinant human HP1 alpha (amino acids: 1-191) protein

    Predicted band size: 22 kDa



    Expected recombinant MW is 48.2 kDa

References

ab234085 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234085.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up