Overview

  • Product name

  • Description

    Rabbit polyclonal to HP1 alpha
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein (GST-tag) corresponding to Human HP1 alpha aa 1-191.
    Sequence:

    MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNT WEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADD IKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADL VLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS


    Database link: P45973

  • Positive control

    • WB: HeLa nuclear extract. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab231559 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 22 kDa.
ICC/IF 1/500.

Target

  • Function

    Component of heterochromatin that recognizes and binds histone H3 tails methylated at 'Lys-9' (H3K9me), leading to epigenetic repression. In contrast, it is excluded from chromatin when 'Tyr-41' of histone H3 is phosphorylated (H3Y41ph). Can interact with lamin-B receptor (LBR). This interaction can contribute to the association of the heterochromatin with the inner nuclear membrane. Involved in the formation of functional kinetochore through interaction with MIS12 complex proteins.
  • Sequence similarities

    Contains 2 chromo domains.
  • Post-translational
    modifications

    Phosphorylation of HP1 and LBR may be responsible for some of the alterations in chromatin organization and nuclear structure which occur at various times during the cell cycle (By similarity). Phosphorylated during interphase and possibly hyper-phosphorylated during mitosis.
    Ubiquitinated.
  • Cellular localization

    Nucleus. Chromosome. Chromosome > centromere. Component of centromeric and pericentromeric heterochromatin. Associates with chromosomes during mitosis. Associates specifically with chromatin during metaphase and anaphase.
  • Information by UniProt
  • Database links

  • Alternative names

    • Antigen p25 antibody
    • CBX5 antibody
    • CBX5_HUMAN antibody
    • CG8409 antibody
    • Chromobox 5 antibody
    • Chromobox homolog 5 (HP1 alpha homolog, Drosophila) antibody
    • Chromobox homolog 5 antibody
    • Chromobox protein homolog 5 antibody
    • Epididymis luminal protein 25 antibody
    • HEL25 antibody
    • Heterochromatin protein 1 alpha antibody
    • Heterochromatin protein 1 antibody
    • Heterochromatin protein 1 homolog alpha antibody
    • HP1 alpha antibody
    • HP1 alpha homolog antibody
    • HP1 antibody
    • HP1A antibody
    • HP1Hs alpha antibody
    • Su(var)205 antibody
    see all

Images

  • Anti-HP1 alpha antibody (ab231559) at 1/1000 dilution + HeLa (Human epithelial cell line from cervix adenocarcinoma) nuclear extract at 20 µg

    Predicted band size: 22 kDa



    Dilution buffer: TBS-Tween containing 5% skimmed milk.

  • HeLa (Human epithelial cell line from cervix adenocarcinoma) cells stained for HP1 alpha using ab231559 at a dilution of 1/500 (Left panel) in ICC/IF. Cells were fxed with 4% formaldehyde for 10 minutes and blocked with PBS/TX-100 containing 5% normal goat serum and 1% BSA. An anti-rabbit antibody conjugated to Alexa-Fluor®488 was used as the secondary antibody. Central panel is DAPI. Right panel merged images.

References

ab231559 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231559.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up