Overview

  • Product name

  • Description

    Rabbit polyclonal to HP1BP3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human HP1BP3 aa 188-285.
    Sequence:

    IHKYPSLELERRGYLLKQALKRELNRGVIKQVKGKGASGSFVVVQKSRKT PQKSRNRKNRSSAVDPEPQVKLEDVLPLAFTRLCEPKEASYSLIRKYV


    Database link: Q5SSJ5

  • Positive control

    • IHC-P: Human pancreas tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224754 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Component of heterochromatin that maintains heterochromatin integrity during G1/S progression and regulates the duration of G1 phase to critically influence cell proliferative capacity (PubMed:24830416). Mediates chromatin condensation during hypoxia, leading to increased tumor cell viability, radio-resistance, chemo-resistance and self-renewal(PubMed:25100860).
  • Sequence similarities

    Contains 3 H15 (linker histone H1/H5 globular) domains.
  • Domain

    A central region that included the first H15 (linker histone H1/H5 globular) domain binds at the entry/exit site of the nucleosomal DNA.
  • Cellular localization

    Nucleus. Chromosome. localized in nuclei but not in nucleoli in interphase. Colocalized with chromosomes in mitosis, with a gradually increased during G1 progression and a maximum level during late G1 phase (G1/S).
  • Information by UniProt
  • Database links

  • Alternative names

    • Heterochromatin protein 1, binding protein 3 antibody
    • Heterochromatin protein 1-binding protein 3 antibody
    • HP1 BP74 antibody
    • HP1B3_HUMAN antibody
    • HP1BP 3 antibody
    • HP1BP3 antibody
    • MGC28927 antibody
    • MGC43701 antibody
    • MGC72624 antibody
    • OTTHUMP00000002717 antibody
    • OTTHUMP00000002719 antibody
    • OTTHUMP00000002720 antibody
    • Protein HP1 BP74 antibody
    • Protein HP1-BP74 antibody
    • RP5 930J4.3 antibody
    see all

Images

  • Paraffin-embedded human pancreas tissue stained for HP1BP3 using ab224754 at 1/200 dilution in immunohistochemical analysis.

References

ab224754 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224754.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up