Overview

  • Product name

    Anti-HPCAL4 antibody [OTI3F11]
  • Description

    Mouse monoclonal [OTI3F11] to HPCAL4
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human HPCAL4 aa 2-191. Produced in E.coli (NP_057341).
    Sequence:

    GKTNSKLAPEVLEDLVQNTEFSEQELKQWYKGFLKDCPSGILNLEEFQQL YIKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSVTSRGSFEQKL NWAFEMYDLDGDGRITRLEMLEIIEAIYKMVGTVIMMRMNQDGLTPQQRV DKIFKKMDQDKDDQITLEEFKEAAKSDPSIVLLLQCDMQK


    Database link: Q9UM19

  • Positive control

    • WB: HEK-293T cell lysates transfected with pCMV6-ENTRY HPCAL4 cDNA for 48 hrs.
  • General notes

    Clone OTI3F11 (formerly 3F11).

Properties

Applications

Our Abpromise guarantee covers the use of ab236390 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 22 kDa.

Target

Images

  • All lanes : Anti-HPCAL4 antibody [OTI3F11] (ab236390) at 1/2000 dilution

    Lane 1 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysates transfected with pCMV6-ENTRY control cDNA for 48 hrs
    Lane 2 : HEK-293T cell lysates transfected with pCMV6-ENTRY HPCAL4 cDNA for 48 hrs

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 22 kDa

References

ab236390 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236390.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up