Overview

  • Product name

  • Description

    Rabbit polyclonal to HPD
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Cow
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human HPD aa 2-393. Two N-terminal tags. (Expressed in E.coli).
    Sequence:

    TTYSDKGAKPERGRFLHFHSVTFWVGNAKQAASFYCSKMGFEPLAYRGLE TGSREVVSHVIKQGKIVFVLSSALNPWNKEMGDHLVKHGDGVKDIAFEVE DCDYIVQKARERGAKIMREPWVEQDKFGKVKFAVLQTYGDTTHTLVEKMN YIGQFLPGYEAPAFMDPLLPKLPKCSLEMIDHIVGNQPDQEMVSASEWYL KNLQFHRFWSVDDTQVHTEYSSLRSIVVANYEESIKMPINEPAPGKKKSQ IQEYVDYNGGAGVQHIALKTEDIITAIRHLRERGLEFLSVPSTYYKQLRE KLKTAKIKVKENIDALEELKILVDYDEKGYLLQIFTKPVQDRPTLFLEVI QRHNHQGFGAGNFNSLFKAFEEEQNLRGNLTNMETNGVVPGM


    Database link: P32754

  • Positive control

    • ICC/IF: HepG2 cells. WB: Recombinant human HPD protein; Human liver lysate; HepG2 and Jurkat cell lysate; Pig kidney lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab232906 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 45 kDa.
ICC/IF Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Key enzyme in the degradation of tyrosine.
  • Pathway

    Amino-acid degradation; L-phenylalanine degradation; acetoacetate and fumarate from L-phenylalanine: step 3/6.
  • Involvement in disease

    Tyrosinemia 3
    Hawkinsinuria
  • Sequence similarities

    Belongs to the 4HPPD family.
  • Information by UniProt
  • Database links

  • Alternative names

    • 4 HPPD antibody
    • 4 hydroxyphenylpyruvate dioxygenase antibody
    • 4 hydroxyphenylpyruvic acid oxidase antibody
    • 4-hydroxyphenylpyruvate dioxygenase antibody
    • 4-hydroxyphenylpyruvic acid oxidase antibody
    • 4HPPD antibody
    • GLOD3 antibody
    • glyoxalase domain containing 3 antibody
    • HPD antibody
    • HPPD_HUMAN antibody
    • HPPDase antibody
    • PPD antibody
    see all

Images

  • Anti-HPD antibody (ab232906) at 2 µg/ml + Pig kidney tissue lysate.

    Predicted band size: 45 kDa

  • Anti-HPD antibody (ab232906) at 2 µg/ml + Jurkat (human T cell leukemia cell line from peripheral blood) cell lysate.

    Predicted band size: 45 kDa

  • Anti-HPD antibody (ab232906) at 2 µg/ml + HepG2 (human liver hepatocellular carcinoma cell line) cell lysate.

    Predicted band size: 45 kDa

  • Anti-HPD antibody (ab232906) at 2 µg/ml + Human liver tissue lysate.

    Predicted band size: 45 kDa

  • Anti-HPD antibody (ab232906) at 2 µg/ml + Recombinant human HPD protein.

    Predicted band size: 45 kDa

  • HepG2 (human liver hepatocellular carcinoma cell line) cells labelling HPD (green) using ab232906 at 20µg/mL in ICC/IF. FITC staining.

References

ab232906 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232906.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up