Overview

  • Product name

  • Description

    Rabbit polyclonal to HPR
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee, Orangutan
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human HPR aa 70-332. (Expressed in E.coli).
    Sequence:

    NDKKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQA KMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGK KQLVEIEKVVLHPNYHQVDIGLIKLKQKVLVNERVMPICLPSKNYAEVGR VGYVSGWGQSDNFKLTDHLKYVMLPVADQYDCITHYEGSTCPKWKAPKSP VGVQPILNEHTFCVGMSKYQEDTCYGDAGSAFAVHDLEEDTWYAAGILSF DKSCAVAEYGVYV


    Database link: P00739

  • Positive control

    • WB: Human serum; Recombinant human HPR protein. IHC-P: Human liver, prostate cancer, breast cancer, stomach cancer and colorectal cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233006 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 39 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

Images

  • Formalin-fixed, paraffin-embedded human colorectal cancer tissue stained for HPR using ab233006 at 10 µg/ml in immunohistochemical analysis. DAB staining. 

  • Formalin-fixed, paraffin-embedded human stomach cancer tissue stained for HPR using ab233006 at 10 µg/ml in immunohistochemical analysis. DAB staining. 

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for HPR using ab233006 at 10 µg/ml in immunohistochemical analysis. DAB staining. 

  • Formalin-fixed, paraffin-embedded human prostate cancer tissue stained for HPR using ab233006 at 10 µg/ml in immunohistochemical analysis. DAB staining. 

  • Formalin-fixed, paraffin-embedded human liver tissue stained for HPR using ab233006 at 10 µg/ml in immunohistochemical analysis. DAB staining. 

  • Anti-HPR antibody (ab233006) at 3 µg/ml + Human serum

    Secondary
    HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution

    Predicted band size: 39 kDa

  • Anti-HPR antibody (ab233006) at 3 µg/ml + Recombinant human HPR protein

    Secondary
    HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution

    Predicted band size: 39 kDa

References

ab233006 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233006.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up