For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    hprt-antibody-ab233137.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Epigenetics and Nuclear Signaling DNA / RNA DNA / Nucleotides
Share by email

Anti-HPRT antibody (ab233137)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-HPRT antibody (ab233137)
  • Western blot - Anti-HPRT antibody (ab233137)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HPRT antibody (ab233137)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HPRT antibody (ab233137)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HPRT antibody (ab233137)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HPRT antibody (ab233137)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HPRT antibody (ab233137)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HPRT antibody (ab233137)

Key features and details

  • Rabbit polyclonal to HPRT
  • Suitable for: WB, IHC-P
  • Reacts with: Rat, Human

You may also be interested in

Secondary
Product image
Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
Protein
Product image
Recombinant human HPRT protein (Active) (ab222951)

View more associated products

Overview

  • Product name

    Anti-HPRT antibody
    See all HPRT primary antibodies
  • Description

    Rabbit polyclonal to HPRT
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse, Chicken, Cow, Dog, Pig, Chimpanzee, Cynomolgus monkey
  • Immunogen

    Recombinant full length protein corresponding to Human HPRT aa 3-218. N-terminal His-tag and GST-tag. Expressed in E.coli.
    Sequence:

    TRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARD VMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRL KSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQ YNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDL NHVCVISETGKAKYKA


    Database link: P00492
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: Recombinant human HPRT protein; Rat liver and brain lysates; HeLa, HepG2 and A549 cell lysates. IHC-P: Human lung cancer, liver, liver cancer, glioma, breast cancer and prostate tissue.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Research areas

    • Epigenetics and Nuclear Signaling
    • DNA / RNA
    • DNA / Nucleotides
    • Cell Biology
    • Other Antibodies
    • Other Antibodies

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Positive Controls

    • HeLa whole cell lysate (ab150035)
    • HepG2 whole cell lysate (ab166833)
    • HeLa whole cell lysate (ab29545)
    • A549 whole cell lysate (ab7910)
  • Recombinant Protein

    • Recombinant human HPRT protein (Active) (ab222951)
  • Related Products

    • Recombinant human HPRT protein (Active) (ab222951)
    • Recombinant Human HPRT protein (ab97411)

Applications

Our Abpromise guarantee covers the use of ab233137 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 25 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Converts guanine to guanosine monophosphate, and hypoxanthine to inosine monophosphate. Transfers the 5-phosphoribosyl group from 5-phosphoribosylpyrophosphate onto the purine. Plays a central role in the generation of purine nucleotides through the purine salvage pathway.
  • Pathway

    Purine metabolism; IMP biosynthesis via salvage pathway; IMP from hypoxanthine: step 1/1.
  • Involvement in disease

    Defects in HPRT1 are the cause of Lesch-Nyhan syndrome (LNS) [MIM:300322]. LNS is characterized by complete lack of enzymatic activity that results in hyperuricemia, choreoathetosis, mental retardation, and compulsive self-mutilation.
    Defects in HPRT1 are the cause of gout HPRT-related (GOUT-HPRT) [MIM:300323]; also known as HPRT-related gout or Kelley-Seegmiller syndrome. Gout is characterized by partial enzyme activity and hyperuricemia.
  • Sequence similarities

    Belongs to the purine/pyrimidine phosphoribosyltransferase family.
  • Cellular localization

    Cytoplasm.
  • Target information above from: UniProt accession P00492 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 395653 Chicken
    • Entrez Gene: 281229 Cow
    • Entrez Gene: 3251 Human
    • Entrez Gene: 15452 Mouse
    • Entrez Gene: 24465 Rat
    • Omim: 308000 Human
    • SwissProt: Q9W719 Chicken
    • SwissProt: A5A6I1 Chimpanzee
    • SwissProt: Q3SZ18 Cow
    • SwissProt: Q6LDD9 Cynomolgus monkey
    • SwissProt: Q6WIT9 Dog
    • SwissProt: P00492 Human
    • SwissProt: P00493 Mouse
    • SwissProt: Q45FY6 Pig
    • SwissProt: P27605 Rat
    • Unigene: 412707 Human
    • Unigene: 299381 Mouse
    • Unigene: 47 Rat
    see all
  • Alternative names

    • HGPRT antibody
    • HGPRTase antibody
    • HPRT 1 antibody
    • HPRT_HUMAN antibody
    • HPRT1 antibody
    • Hypoxanthine guanine phosphoribosyltransferase antibody
    • Hypoxanthine phosphoribosyltransferase 1 (Lesch Nyhan syndrome) antibody
    • Hypoxanthine phosphoribosyltransferase 1 antibody
    • Hypoxanthine-guanine phosphoribosyltransferase antibody
    see all

Images

  • Western blot - Anti-HPRT antibody (ab233137)
    Western blot - Anti-HPRT antibody (ab233137)
    Anti-HPRT antibody (ab233137) at 5 µg/ml + Recombinant human HPRT protein

    Predicted band size: 25 kDa

  • Western blot - Anti-HPRT antibody (ab233137)
    Western blot - Anti-HPRT antibody (ab233137)
    All lanes : Anti-HPRT antibody (ab233137) at 3 µg/ml

    Lane 1 : Rat liver lysate
    Lane 2 : Rat brain lysate
    Lane 3 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 4 : HepG2 (human liver hepatocellular carcinoma cell line) cell lysate
    Lane 5 : A549 (human lung carcinoma cell line) cell lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 25 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HPRT antibody (ab233137)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HPRT antibody (ab233137)

    Formalin-fixed, paraffin-embedded human lung cancer tissue stained for HPRT using ab233137 at 10 μg/ml in immunohistochemical analysis. DAB staining.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HPRT antibody (ab233137)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HPRT antibody (ab233137)

    Formalin-fixed, paraffin-embedded human liver tissue stained for HPRT using ab233137 at 10 μg/ml in immunohistochemical analysis. DAB staining.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HPRT antibody (ab233137)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HPRT antibody (ab233137)

    Formalin-fixed, paraffin-embedded human liver cancer tissue stained for HPRT using ab233137 at 10 μg/ml in immunohistochemical analysis. DAB staining.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HPRT antibody (ab233137)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HPRT antibody (ab233137)

    Formalin-fixed, paraffin-embedded human glioma tissue stained for HPRT using ab233137 at 10 μg/ml in immunohistochemical analysis. DAB staining.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HPRT antibody (ab233137)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HPRT antibody (ab233137)

    Formalin-fixed, paraffin-embedded human breast cancer tissue stained for HPRT using ab233137 at 10 μg/ml in immunohistochemical analysis. DAB staining.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HPRT antibody (ab233137)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HPRT antibody (ab233137)

    Formalin-fixed, paraffin-embedded human prostate tissue stained for HPRT using ab233137 at 10 μg/ml in immunohistochemical analysis. DAB staining.

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab233137? Please let us know so that we can cite the reference in this datasheet.

    ab233137 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab233137.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.