Anti-HPRT antibody (ab233137)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-HPRT antibody
See all HPRT primary antibodies -
Description
Rabbit polyclonal to HPRT -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Rat, Human
Predicted to work with: Mouse, Chicken, Cow, Dog, Pig, Chimpanzee, Cynomolgus monkey
-
Immunogen
Recombinant full length protein corresponding to Human HPRT aa 3-218. N-terminal His-tag and GST-tag. Expressed in E.coli.
Sequence:TRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARD VMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRL KSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQ YNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDL NHVCVISETGKAKYKA
Database link: P00492 -
Positive control
- WB: Recombinant human HPRT protein; Rat liver and brain lysates; HeLa, HepG2 and A549 cell lysates. IHC-P: Human lung cancer, liver, liver cancer, glioma, breast cancer and prostate tissue.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.02% Sodium azide
Constituent: PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Research areas
Associated products
-
Compatible Secondaries
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab233137 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 25 kDa. | |
| IHC-P | Use a concentration of 5 - 20 µg/ml. |
Target
-
Function
Converts guanine to guanosine monophosphate, and hypoxanthine to inosine monophosphate. Transfers the 5-phosphoribosyl group from 5-phosphoribosylpyrophosphate onto the purine. Plays a central role in the generation of purine nucleotides through the purine salvage pathway. -
Pathway
Purine metabolism; IMP biosynthesis via salvage pathway; IMP from hypoxanthine: step 1/1. -
Involvement in disease
Defects in HPRT1 are the cause of Lesch-Nyhan syndrome (LNS) [MIM:300322]. LNS is characterized by complete lack of enzymatic activity that results in hyperuricemia, choreoathetosis, mental retardation, and compulsive self-mutilation.
Defects in HPRT1 are the cause of gout HPRT-related (GOUT-HPRT) [MIM:300323]; also known as HPRT-related gout or Kelley-Seegmiller syndrome. Gout is characterized by partial enzyme activity and hyperuricemia. -
Sequence similarities
Belongs to the purine/pyrimidine phosphoribosyltransferase family. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 395653 Chicken
- Entrez Gene: 281229 Cow
- Entrez Gene: 3251 Human
- Entrez Gene: 15452 Mouse
- Entrez Gene: 24465 Rat
- Omim: 308000 Human
- SwissProt: Q9W719 Chicken
- SwissProt: A5A6I1 Chimpanzee
see all -
Alternative names
- HGPRT antibody
- HGPRTase antibody
- HPRT 1 antibody
see all
Images
-
Western blot - Anti-HPRT antibody (ab233137)Anti-HPRT antibody (ab233137) at 5 µg/ml + Recombinant human HPRT protein
Predicted band size: 25 kDa -
Western blot - Anti-HPRT antibody (ab233137)All lanes : Anti-HPRT antibody (ab233137) at 3 µg/ml
Lane 1 : Rat liver lysate
Lane 2 : Rat brain lysate
Lane 3 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
Lane 4 : HepG2 (human liver hepatocellular carcinoma cell line) cell lysate
Lane 5 : A549 (human lung carcinoma cell line) cell lysate
Secondary
All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution
Predicted band size: 25 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HPRT antibody (ab233137)Formalin-fixed, paraffin-embedded human lung cancer tissue stained for HPRT using ab233137 at 10 μg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HPRT antibody (ab233137)Formalin-fixed, paraffin-embedded human liver tissue stained for HPRT using ab233137 at 10 μg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HPRT antibody (ab233137)Formalin-fixed, paraffin-embedded human liver cancer tissue stained for HPRT using ab233137 at 10 μg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HPRT antibody (ab233137)Formalin-fixed, paraffin-embedded human glioma tissue stained for HPRT using ab233137 at 10 μg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HPRT antibody (ab233137)Formalin-fixed, paraffin-embedded human breast cancer tissue stained for HPRT using ab233137 at 10 μg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HPRT antibody (ab233137)Formalin-fixed, paraffin-embedded human prostate tissue stained for HPRT using ab233137 at 10 μg/ml in immunohistochemical analysis. DAB staining.
Datasheets and documents
References
ab233137 has not yet been referenced specifically in any publications.
