Anti-HPRT antibody (ab233137)
Key features and details
- Rabbit polyclonal to HPRT
- Suitable for: WB, IHC-P
- Reacts with: Rat, Human
Overview
-
Product name
Anti-HPRT antibody
See all HPRT primary antibodies -
Description
Rabbit polyclonal to HPRT -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Rat, Human
Predicted to work with: Mouse, Chicken, Cow, Dog, Pig, Chimpanzee, Cynomolgus monkey -
Immunogen
Recombinant full length protein corresponding to Human HPRT aa 3-218. N-terminal His-tag and GST-tag. Expressed in E.coli.
Sequence:TRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARD VMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRL KSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQ YNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDL NHVCVISETGKAKYKA
Database link: P00492 -
Positive control
- WB: Recombinant human HPRT protein; Rat liver and brain lysates; HeLa, HepG2 and A549 cell lysates. IHC-P: Human lung cancer, liver, liver cancer, glioma, breast cancer and prostate tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Research areas
Associated products
-
Compatible Secondaries
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab233137 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 25 kDa. | |
IHC-P | Use a concentration of 5 - 20 µg/ml. |
Target
-
Function
Converts guanine to guanosine monophosphate, and hypoxanthine to inosine monophosphate. Transfers the 5-phosphoribosyl group from 5-phosphoribosylpyrophosphate onto the purine. Plays a central role in the generation of purine nucleotides through the purine salvage pathway. -
Pathway
Purine metabolism; IMP biosynthesis via salvage pathway; IMP from hypoxanthine: step 1/1. -
Involvement in disease
Defects in HPRT1 are the cause of Lesch-Nyhan syndrome (LNS) [MIM:300322]. LNS is characterized by complete lack of enzymatic activity that results in hyperuricemia, choreoathetosis, mental retardation, and compulsive self-mutilation.
Defects in HPRT1 are the cause of gout HPRT-related (GOUT-HPRT) [MIM:300323]; also known as HPRT-related gout or Kelley-Seegmiller syndrome. Gout is characterized by partial enzyme activity and hyperuricemia. -
Sequence similarities
Belongs to the purine/pyrimidine phosphoribosyltransferase family. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 395653 Chicken
- Entrez Gene: 281229 Cow
- Entrez Gene: 3251 Human
- Entrez Gene: 15452 Mouse
- Entrez Gene: 24465 Rat
- Omim: 308000 Human
- SwissProt: Q9W719 Chicken
- SwissProt: A5A6I1 Chimpanzee
see all -
Alternative names
- HGPRT antibody
- HGPRTase antibody
- HPRT 1 antibody
see all
Images
-
Anti-HPRT antibody (ab233137) at 5 µg/ml + Recombinant human HPRT protein
Predicted band size: 25 kDa -
All lanes : Anti-HPRT antibody (ab233137) at 3 µg/ml
Lane 1 : Rat liver lysate
Lane 2 : Rat brain lysate
Lane 3 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
Lane 4 : HepG2 (human liver hepatocellular carcinoma cell line) cell lysate
Lane 5 : A549 (human lung carcinoma cell line) cell lysate
Secondary
All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution
Predicted band size: 25 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HPRT antibody (ab233137)
Formalin-fixed, paraffin-embedded human lung cancer tissue stained for HPRT using ab233137 at 10 μg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HPRT antibody (ab233137)
Formalin-fixed, paraffin-embedded human liver tissue stained for HPRT using ab233137 at 10 μg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HPRT antibody (ab233137)
Formalin-fixed, paraffin-embedded human liver cancer tissue stained for HPRT using ab233137 at 10 μg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HPRT antibody (ab233137)
Formalin-fixed, paraffin-embedded human glioma tissue stained for HPRT using ab233137 at 10 μg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HPRT antibody (ab233137)
Formalin-fixed, paraffin-embedded human breast cancer tissue stained for HPRT using ab233137 at 10 μg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HPRT antibody (ab233137)
Formalin-fixed, paraffin-embedded human prostate tissue stained for HPRT using ab233137 at 10 μg/ml in immunohistochemical analysis. DAB staining.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab233137 has not yet been referenced specifically in any publications.