Overview

  • Product name

  • Description

    Rabbit polyclonal to HPS4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse HPS4 aa 20-214. Expressed in E.coli.
    Sequence:

    LYDGSKVKGEGDPTRAGICYFYPPQTLLDQQELLCGQLAGVVRCLWDLSG TPPMLIRMRNLKFAIRADGDYLWALGCGVEISDASCRQFLDQLIGFFHFY MGPVSLAYKSHPQEELSLQWDTSITQVLRSTSESHRIFNALWNLDRTKVE PLLLLKAALILQTCQRSPHVLAGCILYKGLIVNSQLLPSLTAKVL


    Database link: Q99KG7

  • Positive control

    • WB: Recombinant mouse HSP4; Mouse liver lysate. IHC-P: Mouse cerebrum, ovary and kidney tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231189 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 77 kDa.

Target

  • Relevance

    Hermansky-Pudlak syndrome is a disorder of organelle biogenesis in which oculocutaneous albinism, bleeding, and pulmonary fibrosis result from defects of melanosomes, platelet dense granules, and lysosomes. Mutations in HPS4 gene as well as several others can cause this syndrome. HPS4 appears to be important in organelle biogenesis and is similar to the mouse 'light ear' protein. Five transcript variants encoding different isoforms have been found for this gene. In addition, transcript variants utilizing alternative polyadenylation signals exist.
  • Cellular localization

    lysosome, melanosome, membrane fraction and platelet dense granule
  • Database links

  • Alternative names

    • Hermansky Pudlak syndrome 4 protein antibody
    • Light ear protein homolog antibody

Images

  • Anti-HPS4 antibody (ab231189) at 2 µg/ml + Recombinant mouse HSP4

    Predicted band size: 77 kDa

  • Anti-HPS4 antibody (ab231189) at 2 µg/ml + Mouse liver lysate

    Predicted band size: 77 kDa

  • Formalin-fixed, paraffin-embedded mouse cerebrum tissue stained for HSP4 using ab231189 at 20 mg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse ovary tissue stained for HSP4 using ab231189 at 20 mg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse kidney tissue stained for HSP4 using ab231189 at 20 mg/ml in immunohistochemical analysis. DAB staining.

References

ab231189 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231189.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up