Overview

  • Product name

  • Description

    Rabbit polyclonal to HRG
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat HRG aa 106-302. Expressed in E.coli.
    Sequence:

    IATRYSNESQDLSVNGYNCTMRSVSSAYINTKDSPVLVDSFEDSEPYRKL ARKALDKYKAENGDFASFRVERAERVIRMRGGERTSYFIEFSVRNCSTQH FPRHPPVFGLCRVVLTYSTEASDLETPEYTDLICEVFNTEDLKNRSDMKP HRGHEHPHCDKHLCKLSGPRDHHHTHKTHEIGCPPPPEGKDNSDRPP


    Database link: Q99PS8

  • Positive control

    • IHC-P: Rat liver tissue. WB: Rat serum; Recombinant Rat HRG protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab230995 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230995 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 59 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Relevance

    HRG (histidine-rich glycoprotein) contains two cystatin-like domains and is located in plasma and platelets. The physiological function is not yet known. It binds heme, dyes and divalent metal ions. It can inhibit rosette formation and interacts with heparin, thrombospondin, and the lysine-binding site of plasminogen. A potential prothrombotic effect of HRG is indicated by the inhibition of fibrinolysis and the reduction of inhibition of coagulation. Mutations in HRG lead to thrombophilia due to abnormal histidine-rich glycoprotein levels.
  • Cellular localization

    Secreted
  • Database links

  • Alternative names

    • DKFZp779H1622 antibody
    • Histidine proline rich glycoprotein antibody
    • Histidine rich glycoprotein antibody
    • HPRG antibody
    • HRGP antibody
    • Thrombophilia due to elevated HRG antibody
    see all

Images

  • Paraffin-embedded rat liver tissue stained for HRG using ab230995 at 20 µg/ml in immunohistochemical analysis.

  • Anti-HRG antibody (ab230995) at 2 µg/ml + Rat serum

    Predicted band size: 59 kDa

  • Anti-HRG antibody (ab230995) at 2 µg/ml + Recombinant Rat HRG protein

    Predicted band size: 59 kDa

References

ab230995 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230995.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up