Anti-HRP antibody (ab181708)
Key features and details
- Mouse polyclonal to HRP
- Suitable for: WB
- Reacts with: Horseradish
- Isotype: IgG
Overview
-
Product name
Anti-HRP antibody
See all HRP primary antibodies -
Description
Mouse polyclonal to HRP -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Horseradish -
Immunogen
Full length native protein (purified) corresponding to HRP aa 31-338.
Sequence:QLTPTFYDNSCPNVSNIVRDTIVNELRSDPRIAASILRLHFHDCFVNGCD ASILLDNTTSFRTEKDAFGNANSARGFPVIDRMKAAVESACPRTVSCADL LTIAAQQSVTLAGGPSWRVPLGRRDSLQAFLDLANANLPAPFFTLPQLKD SFRNVGLNRSSDLVALSGGHTFGKNQCRFIMDRLYNFSNTGLPDPTLNTT YLQTLRGLCPLNGNLSALVDFDLRTPTIFDNKYYVNLEEQKGLIQSDQEL FSSPNATDTIPLVRSFANSTQTFFNAFVEAMDRMGNITPLTGTQGQIRLN CRVVNSNS
Database link: P00433 -
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Constituents: 0.88% Sodium chloride, 0.27% Potassium phosphate
Does not contain preservative or stabilizer -
Concentration information loading...
-
Purity
IgG fraction -
Purification notes
ab181708 is an IgG fraction antibody purified from monospecific antiserum by a multi-step process which includes delipidation, salt fractionation and ion exchange chromatography followed by extensive dialysis against the stated buffer stated. Assay by immunoelectrophoresis resulted in a single precipitin arc against anti-Mouse Serum as well as purified and partially purified Peroxidase [Horseradish]. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Related Products
- TMB ELISA Substrate (Highest Sensitivity) (ab171522)
- TMB ELISA Substrate (High Sensitivity) (ab171523)
- TMB ELISA Substrate (Fast Kinetic Rate) (ab171524)
- TMB ELISA Substrate (Slow Kinetic Rate) (ab171525)
- TMB ELISA Substrate (Slower Kinetic Rate) (ab171526)
- TMB ELISA Substrate (Slowest Kinetic Rate) (ab171527)
- 450 nm Stop Solution for TMB Substrate (ab171529)
- 650 nm Stop Solution for TMB Substrate (ab171531)
- Immunoassay Blocking Buffer (ab171534)
- Immunoassay Blocking (BSA Free) (ab171535)
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab181708 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/500 - 1/3000. Predicted molecular weight: 39 kDa.
|
Notes |
---|
WB
1/500 - 1/3000. Predicted molecular weight: 39 kDa. |
Target
-
Relevance
Horseradish Peroxidase (HRP) is an enzyme commonly used as an indicator for chemical reactions which produce peroxide. The enzyme is routinely conjugated to antibodies for use in enzyme-based immunoassay systems. HRP functions in the removal of H2O2 (hydrogen peroxide), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress. These functions might be dependent on each isozyme/isoform in each plant tissue. -
Cellular localization
Secreted Probable. Vacuole Probable. Note: Carboxy-terminal extension appears to target the protein to vacuoles. -
Database links
- SwissProt: P00433 Horseradish
-
Alternative names
- Horseradish Peroxidase antibody
- HPRC1 antibody
- HRP antibody
see all
Images
-
Anti-HRP antibody (ab181708) at 1/1000 dilution (overnight at 4°C) + Peroxidase (Horseradish) at 0.1 µg
Secondary
Fluorescein conjugated mouse secondary antibody for 30 minutes at room temperature at 1/40000 dilution
Predicted band size: 39 kDa
Observed band size: 44 kDa why is the actual band size different from the predicted?Block: Blocking Buffer for Fluorescent Western Blotting for 30 minutes at room temperature.
Protocols
Datasheets and documents
-
Datasheet download
References (1)
ab181708 has been referenced in 1 publication.
- Yin Y et al. A basal-level activity of ATR links replication fork surveillance and stress response. Mol Cell 81:4243-4257.e6 (2021). PubMed: 34473946