Overview

  • Product name

  • Description

    Mouse polyclonal to HRP
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Horseradish
  • Immunogen

    Full length native protein (purified) corresponding to HRP aa 31-338.
    Sequence:

    QLTPTFYDNSCPNVSNIVRDTIVNELRSDPRIAASILRLHFHDCFVNGCD ASILLDNTTSFRTEKDAFGNANSARGFPVIDRMKAAVESACPRTVSCADL LTIAAQQSVTLAGGPSWRVPLGRRDSLQAFLDLANANLPAPFFTLPQLKD SFRNVGLNRSSDLVALSGGHTFGKNQCRFIMDRLYNFSNTGLPDPTLNTT YLQTLRGLCPLNGNLSALVDFDLRTPTIFDNKYYVNLEEQKGLIQSDQEL FSSPNATDTIPLVRSFANSTQTFFNAFVEAMDRMGNITPLTGTQGQIRLN CRVVNSNS


    Database link: P00433

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Constituents: 0.88% Sodium chloride, 0.27% Potassium phosphate

    Does not contain preservative or stabilizer
  • Concentration information loading...
  • Purity

    IgG fraction
  • Purification notes

    ab181708 is an IgG fraction antibody purified from monospecific antiserum by a multi-step process which includes delipidation, salt fractionation and ion exchange chromatography followed by extensive dialysis against the stated buffer stated. Assay by immunoelectrophoresis resulted in a single precipitin arc against anti-Mouse Serum as well as purified and partially purified Peroxidase [Horseradish].
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab181708 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/3000. Predicted molecular weight: 39 kDa.
IHC-P Use at an assay dependent concentration.

Target

  • Relevance

    Horseradish Peroxidase (HRP) is an enzyme commonly used as an indicator for chemical reactions which produce peroxide. The enzyme is routinely conjugated to antibodies for use in enzyme-based immunoassay systems. HRP functions in the removal of H2O2 (hydrogen peroxide), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress. These functions might be dependent on each isozyme/isoform in each plant tissue.
  • Cellular localization

    Secreted Probable. Vacuole Probable. Note: Carboxy-terminal extension appears to target the protein to vacuoles.
  • Database links

    • Alternative names

      • Horseradish Peroxidase antibody
      • HPRC1 antibody
      • HRP antibody
      • Peroxidase antibody
      • Peroxidase C1A antibody
      • PRXC1A antibody
      see all

    References

    ab181708 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab181708.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up