HRP Anti-AVPR1B antibody - Cytoplasmic domain (ab193423)
Key features and details
- HRP Rabbit polyclonal to AVPR1B - Cytoplasmic domain
- Reacts with: Rat
- Conjugation: HRP
- Isotype: IgG
Overview
-
Product name
HRP Anti-AVPR1B antibody - Cytoplasmic domain
See all AVPR1B primary antibodies -
Description
HRP Rabbit polyclonal to AVPR1B - Cytoplasmic domain -
Host species
Rabbit -
Conjugation
HRP -
Species reactivity
Reacts with: Rat
Predicted to work with: Mouse -
Immunogen
Recombinant fragment corresponding to Rat AVPR1B aa 343-425. Cytoplasmic domain.
Sequence:NSRLLPRSLSHHACCTGSKPQVHRQLSTSSLTSRRTTLLTHACGSPTLRL SLNLSLRAKPRPAGSLKDLEQVDGEATMETSIF
Database link: P48974 -
General notes
This product was previously labelled as AVPR1B, Vasopressin V1b receptor
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), 49% PBS, 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Caprylic Acid - Ammonium Sulfate precipitation -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Target
-
Function
Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger system. -
Sequence similarities
Belongs to the G-protein coupled receptor 1 family. Vasopressin/oxytocin receptor subfamily. -
Cellular localization
Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 26361 Mouse
- Entrez Gene: 29462 Rat
- SwissProt: Q9WU02 Mouse
- SwissProt: P48974 Rat
- Unigene: 89986 Mouse
- Unigene: 10096 Rat
-
Alternative names
- Antidiuretic hormone receptor 1b antibody
- Antidiuretic hormone, receptor for, V1B antibody
- Arginine vasopressin receptor 1B antibody
see all
References (0)
ab193423 has not yet been referenced specifically in any publications.