For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    hrp-creatine-kinase-mm-antibody-ab193292.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Metabolism Energy Metabolism
Share by email

HRP Anti-Creatine Kinase MM antibody (ab193292)

  • Datasheet
  • SDS
Submit a review Submit a question References (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - HRP Anti-Creatine Kinase MM antibody (ab193292)

    Key features and details

    • HRP Rabbit polyclonal to Creatine Kinase MM
    • Suitable for: WB
    • Reacts with: Human
    • Conjugation: HRP
    • Isotype: IgG

    Overview

    • Product name

      HRP Anti-Creatine Kinase MM antibody
      See all Creatine Kinase MM primary antibodies
    • Description

      HRP Rabbit polyclonal to Creatine Kinase MM
    • Host species

      Rabbit
    • Conjugation

      HRP
    • Tested applications

      Suitable for: WBmore details
    • Species reactivity

      Reacts with: Human
      Predicted to work with: Mouse, Rat, Rabbit, Chicken, Cow, Dog, Pig
    • Immunogen

      Recombinant full length protein corresponding to Human Creatine Kinase MM aa 1-381.
      Sequence:

      MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSG FTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGY KPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGE RRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSP LLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVF RRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLA HLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQV QLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK


      Database link: P06732
      Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
    • Positive control

      • 293T whole cell lysate (ab95494) can be used as a positive control in WB.
    • General notes

      Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

      Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

      We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

      In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

      We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

      Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

      Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

    Properties

    • Form

      Liquid
    • Storage instructions

      Shipped at 4°C. Store at +4°C.
    • Storage buffer

      pH: 7.40
      Constituents: 50% Glycerol (glycerin, glycerine), 49% PBS, 0.03% Proclin 300
    • Concentration information loading...
    • Purity

      Caprylic Acid - Ammonium Sulfate precipitation
    • Clonality

      Polyclonal
    • Isotype

      IgG
    • Research areas

      • Signal Transduction
      • Metabolism
      • Energy Metabolism
      • Cardiovascular
      • Atherosclerosis
      • Diabetes associated
      • Metabolism
      • Pathways and Processes
      • Metabolic signaling pathways
      • Energy transfer pathways
      • Energy Metabolism
      • Metabolism
      • Types of disease
      • Diabetes
      • Metabolism
      • Types of disease
      • Heart disease

    Associated products

    • Related Products

      • Recombinant Human Creatine Kinase MM protein (ab124319)

    Applications

    Our Abpromise guarantee covers the use of ab193292 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Abreviews Notes
    WB Use at an assay dependent concentration. Detects a band of approximately 42 kDa (predicted molecular weight: 43 kDa).

    Target

    • Function

      Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa.
    • Sequence similarities

      Belongs to the ATP:guanido phosphotransferase family.
      Contains 1 phosphagen kinase C-terminal domain.
      Contains 1 phosphagen kinase N-terminal domain.
    • Cellular localization

      Cytoplasm.
    • Target information above from: UniProt accession P06732 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt
    • Database links

      • Entrez Gene: 476435 Dog
      • Entrez Gene: 1158 Human
      • Entrez Gene: 12715 Mouse
      • Entrez Gene: 24265 Rat
      • Omim: 123310 Human
      • SwissProt: P05123 Dog
      • SwissProt: P06732 Human
      • SwissProt: P07310 Mouse
      • SwissProt: P00564 Rat
      • Unigene: 334347 Human
      • Unigene: 2375 Mouse
      • Unigene: 10756 Rat
      see all
    • Alternative names

      • CKM antibody
      • CKMM antibody
      • Creatine kinase M antibody
      • Creatine kinase M chain antibody
      • Creatine kinase M type antibody
      • Creatine kinase M-type antibody
      • Creatine kinase muscle antibody
      • Creatine kinase, muscle type antibody
      • KCRM_HUMAN antibody
      • M-CK antibody
      • MCK antibody
      • Muscle creatine kinase antibody
      see all

    Images

    • Western blot - HRP Anti-Creatine Kinase MM antibody (ab193292)
      Western blot - HRP Anti-Creatine Kinase MM antibody (ab193292)
      HRP Anti-Creatine Kinase MM antibody (ab193292) at 2 µg/ml + 293T whole cell lysate

      Secondary
      Goat polyclonal to Rabbit IgG at 1/10000 dilution

      Predicted band size: 43 kDa
      Additional bands at: 42 kDa. We are unsure as to the identity of these extra bands.

    Protocols

    • Western blot protocols
    • Immunohistochemistry protocols

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
    • SDS
  • References (1)

    Publishing research using ab193292? Please let us know so that we can cite the reference in this datasheet.

    ab193292 has been referenced in 1 publication.

    • Miotto PM & Holloway GP Exercise-induced reductions in mitochondrial ADP sensitivity contribute to the induction of gene expression and mitochondrial biogenesis through enhanced mitochondrial H2O2 emission. Mitochondrion 46:116-122 (2019). PubMed: 29588219

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab193292.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.