HRP Anti-Creatine Kinase MM antibody (ab193292)
Key features and details
- HRP Rabbit polyclonal to Creatine Kinase MM
- Suitable for: WB
- Reacts with: Human
- Conjugation: HRP
- Isotype: IgG
Overview
-
Product name
HRP Anti-Creatine Kinase MM antibody
See all Creatine Kinase MM primary antibodies -
Description
HRP Rabbit polyclonal to Creatine Kinase MM -
Host species
Rabbit -
Conjugation
HRP -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Rabbit, Chicken, Cow, Dog, Pig -
Immunogen
Recombinant full length protein corresponding to Human Creatine Kinase MM aa 1-381.
Sequence:MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSG FTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGY KPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGE RRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSP LLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVF RRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLA HLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQV QLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK
Database link: P06732 -
Positive control
- 293T whole cell lysate (ab95494) can be used as a positive control in WB.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), 49% PBS, 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Caprylic Acid - Ammonium Sulfate precipitation -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab193292 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use at an assay dependent concentration. Detects a band of approximately 42 kDa (predicted molecular weight: 43 kDa). |
Target
-
Function
Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa. -
Sequence similarities
Belongs to the ATP:guanido phosphotransferase family.
Contains 1 phosphagen kinase C-terminal domain.
Contains 1 phosphagen kinase N-terminal domain. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 476435 Dog
- Entrez Gene: 1158 Human
- Entrez Gene: 12715 Mouse
- Entrez Gene: 24265 Rat
- Omim: 123310 Human
- SwissProt: P05123 Dog
- SwissProt: P06732 Human
- SwissProt: P07310 Mouse
see all -
Alternative names
- CKM antibody
- CKMM antibody
- Creatine kinase M antibody
see all
Images
-
HRP Anti-Creatine Kinase MM antibody (ab193292) at 2 µg/ml + 293T whole cell lysate
Secondary
Goat polyclonal to Rabbit IgG at 1/10000 dilution
Predicted band size: 43 kDa
Additional bands at: 42 kDa. We are unsure as to the identity of these extra bands.
Protocols
References (1)
ab193292 has been referenced in 1 publication.
- Miotto PM & Holloway GP Exercise-induced reductions in mitochondrial ADP sensitivity contribute to the induction of gene expression and mitochondrial biogenesis through enhanced mitochondrial H2O2 emission. Mitochondrion 46:116-122 (2019). PubMed: 29588219