HRP Anti-HLA Class II DRB1 antibody (ab193646)
Key features and details
- HRP Rabbit polyclonal to HLA Class II DRB1
- Reacts with: Human
- Conjugation: HRP
- Isotype: IgG
Overview
-
Product name
HRP Anti-HLA Class II DRB1 antibody
See all HLA Class II DRB1 primary antibodies -
Description
HRP Rabbit polyclonal to HLA Class II DRB1 -
Host species
Rabbit -
Conjugation
HRP -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human HLA Class II DRB1 aa 31-266.
Sequence:DTRPRFLEYSTSECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAVT ELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGVVESFTVQRRVHPKVTV YPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNG DWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLS GVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPRGFLS
Database link: P01911 -
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C. -
Storage buffer
pH: 7.40
Constituents: 49% PBS, 50% Glycerol (glycerin, glycerine), 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Caprylic Acid - Ammonium Sulfate precipitation -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Recombinant Protein
-
Related Products
Target
- Information by UniProt
-
Database links
- Entrez Gene: 3123 Human
- Omim: 142857 Human
- SwissProt: P01911 Human
- SwissProt: P01912 Human
- SwissProt: P04229 Human
- SwissProt: P20039 Human
- SwissProt: Q29974 Human
- SwissProt: Q30134 Human
see all -
Alternative names
- 2B1F_HUMAN antibody
- DR1 antibody
- DR16 antibody
see all
References (0)
ab193646 has not yet been referenced specifically in any publications.