HRP Anti-NMDAR1 antibody [N308/48] - N-terminal (ab183433)

Submit a review Submit a question
Western blot - HRP Anti-NMDAR1 antibody [N308/48] - N-terminal (ab183433)

    Key features and details

    • HRP Mouse monoclonal [N308/48] to NMDAR1 - N-terminal
    • Suitable for: WB
    • Reacts with: Mouse, Rat, Human
    • Conjugation: HRP
    • Isotype: IgG1

    Overview

    • Product name

      HRP Anti-NMDAR1 antibody [N308/48] - N-terminal
      See all NMDAR1 primary antibodies

    • Description

      HRP Mouse monoclonal [N308/48] to NMDAR1 - N-terminal

    • Host species

      Mouse

    • Conjugation

      HRP

    • Tested applications

      Suitable for: WBmore details

    • Species reactivity

      Reacts with: Mouse, Rat, Human

    • Immunogen

      Recombinant fragment corresponding to Rat NMDAR1 aa 42-361 (N terminal). N terminal extracellular domain.
      Sequence:

      FREAVNQANKRHGSWKIQLNATSVTHKPNAIQMALSVCEDLISSQVYAIL VSHPPTPNDHFTPTPVSYTAGFYRIPVLGLTTRMSIYSDKSIHLSFLRTV PPYSHQSSVWFEMMRVYNWNHIILLVSDDHEGRAAQKRLETLLEERESKA EKVLQFDPGTKNVTALLMEARELEARVIILSASEDDAATVYRAAAMLNMT GSGYVWLVGEREISGNALRYAPDGIIGLQLINGKNESAHISDAVGVVAQA VHELLEKENITDPPRGCVGNTNIWKTGPLFKRVLMSSKYADGVTGRVEFN EDGDRKFANYSIMNLQNRKL


      Database link: NP_058706.1
      Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

    • Positive control

      • Rat brain tissue lysate

    • General notes

      The clone number has been updated from S308-48 to N308/48, both clone numbers name the same antibody clone.

       

      Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

      Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

      We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

      In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

      We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

      Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

      Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

    Properties

    Applications

    Our Abpromise guarantee covers the use of ab183433 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Abreviews Notes
    WB Use a concentration of 1 µg/ml. Predicted molecular weight: 105 kDa.

    1 µg/ml of ab183433 is sufficient for detection of NMDAR1 in 20µg of rat brain membrane lysate.

    Target

    • Function

      NMDA receptor subtype of glutamate-gated ion channels with high calcium permeability and voltage-dependent sensitivity to magnesium. Mediated by glycine. This protein plays a key role in synaptic plasticity, synaptogenesis, excitotoxicity, memory acquisition and learning. It mediates neuronal functions in glutamate neurotransmission. Is involved in the cell surface targeting of NMDA receptors.

    • Sequence similarities

      Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. NR1/GRIN1 subfamily.

    • Post-translational
      modifications

      NMDA is probably regulated by C-terminal phosphorylation of an isoform of NR1 by PKC. Dephosphorylated on Ser-897 probably by protein phosphatase 2A (PPP2CB). Its phosphorylated state is influenced by the formation of the NMDAR-PPP2CB complex and the NMDAR channel activity.

    • Cellular localization

      Cell membrane. Cell junction > synapse > postsynaptic cell membrane. Cell junction > synapse > postsynaptic cell membrane > postsynaptic density. Enriched in post-synaptic plasma membrane and post-synaptic densities.
    • Information by UniProt

    • Database links

      see all

    • Alternative names

      • GluN1 antibody
      • Glutamate [NMDA] receptor subunit zeta-1 antibody
      • Glutamate receptor ionotropic N methyl D aspartate 1 antibody
      • Glutamate receptor ionotropic, N-methyl-D aspartate, subunit 1 antibody
      • glutamate receptor ionotropic, NMDA 1 antibody
      • Grin1 antibody
      • MRD8 antibody
      • N methyl D aspartate receptor antibody
      • N methyl D aspartate receptor channel subunit zeta 1 antibody
      • N methyl D aspartate receptor subunit NR1 antibody
      • N-methyl-D-aspartate receptor subunit NR1 antibody
      • NMD-R1 antibody
      • NMDA 1 antibody
      • NMDA R1 antibody
      • NMDA receptor 1 antibody
      • NMDA1 antibody
      • NMDAR antibody
      • NMDZ1_HUMAN antibody
      • NR1 antibody
      see all

    Images

    • Western blot - HRP Anti-NMDAR1 antibody [N308/48] - N-terminal (ab183433)
      Western blot - HRP Anti-NMDAR1 antibody [N308/48] - N-terminal (ab183433)
      HRP Anti-NMDAR1 antibody [N308/48] - N-terminal (ab183433) at 1/1000 dilution + rat brain membrane tissue lysate

      Predicted band size: 105 kDa

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    References (0)

    Publishing research using ab183433? Please let us know so that we can cite the reference in this datasheet.

    ab183433 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab183433.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com