HRP Anti-Plasminogen antibody (ab181649)
Key features and details
- HRP Goat polyclonal to Plasminogen
- Reacts with: Human
- Conjugation: HRP
- Isotype: IgG
Overview
-
Product name
HRP Anti-Plasminogen antibody
See all Plasminogen primary antibodies -
Description
HRP Goat polyclonal to Plasminogen -
Host species
Goat -
Conjugation
HRP -
Species reactivity
Reacts with: Human
Predicted to work with: Rhesus monkey, Orangutan -
Immunogen
Full length protein corresponding to Human Plasminogen aa 20-810. (Purified from plasma).
Sequence:EPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSK EQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTK NGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDP EKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGY IPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSS GPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNL DENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPE LTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNA GLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVL LPDVETPSEEDCMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPE TNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQCAAPSFDCGK PQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLT AAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALL KLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEA QLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEK DKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN
Database link: P00747 -
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C. -
Storage buffer
Preservative: 0.01% Gentamicin sulphate
Constituents: 0.88% Sodium chloride, 0.27% Potassium phosphate, 1% BSA
Do NOT add Sodium Azide! -
Concentration information loading...
-
Purity
IgG fraction -
Purification notes
ab181649 is an IgG fraction antibody purified from monospecific antiserum by a multi-step process which includes delipidation, salt fractionation and ion exchange chromatography followed by extensive dialysis against the buffer stated above. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Recombinant Protein
-
Related Products
- TMB ELISA Substrate (Highest Sensitivity) (ab171522)
- TMB ELISA Substrate (High Sensitivity) (ab171523)
- TMB ELISA Substrate (Fast Kinetic Rate) (ab171524)
- TMB ELISA Substrate (Slow Kinetic Rate) (ab171525)
- TMB ELISA Substrate (Slower Kinetic Rate) (ab171526)
- TMB ELISA Substrate (Slowest Kinetic Rate) (ab171527)
- 450 nm Stop Solution for TMB Substrate (ab171529)
- 650 nm Stop Solution for TMB Substrate (ab171531)
- Immunoassay Blocking Buffer (ab171534)
- Immunoassay Blocking (BSA Free) (ab171535)
- Native Human Plasminogen protein (ab62493)
- Native human Plasminogen protein (ab77879)
- Native human Plasminogen protein (Active) (ab92924)
Target
-
Function
Plasmin dissolves the fibrin of blood clots and acts as a proteolytic factor in a variety of other processes including embryonic development, tissue remodeling, tumor invasion, and inflammation. In ovulation, weakens the walls of the Graafian follicle. It activates the urokinase-type plasminogen activator, collagenases and several complement zymogens, such as C1 and C5. Cleavage of fibronectin and laminin leads to cell detachment and apoptosis. Also cleaves fibrin, thrombospondin and von Willebrand factor. Its role in tissue remodeling and tumor invasion may be modulated by CSPG4. Binds to cells.
Angiostatin is an angiogenesis inhibitor that blocks neovascularization and growth of experimental primary and metastatic tumors in vivo. -
Tissue specificity
Present in plasma and many other extracellular fluids. It is synthesized in the liver. -
Involvement in disease
Defects in PLG are a cause of susceptibility to thrombosis (THR) [MIM:188050]. It is a multifactorial disorder of hemostasis characterized by abnormal platelet aggregation in response to various agents and recurrent thrombi formation.
Defects in PLG are the cause of plasminogen deficiency (PLGD) [MIM:217090]. PLGD is characterized by decreased serum plasminogen activity. Two forms of the disorder are distinguished: type 1 deficiency is additionally characterized by decreased plasminogen antigen levels and clinical symptoms, whereas type 2 deficiency, also known as dysplasminogenemia, is characterized by normal, or slightly reduced antigen levels, and absence of clinical manifestations. Plasminogen deficiency type 1 results in markedly impaired extracellular fibrinolysis and chronic mucosal pseudomembranous lesions due to subepithelial fibrin deposition and inflammation. The most common clinical manifestation of type 1 deficiency is ligneous conjunctivitis in which pseudomembranes formation on the palpebral surfaces of the eye progresses to white, yellow-white, or red thick masses with a wood-like consistency that replace the normal mucosa. -
Sequence similarities
Belongs to the peptidase S1 family. Plasminogen subfamily.
Contains 5 kringle domains.
Contains 1 PAN domain.
Contains 1 peptidase S1 domain. -
Domain
Kringle domains mediate interaction with CSPG4. -
Post-translational
modificationsN-linked glycan contains N-acetyllactosamine and sialic acid. O-linked glycans consist of Gal-GalNAc disaccharide modified with up to 2 sialic acid residues (microheterogeneity).
In the presence of the inhibitor, the activation involves only cleavage after Arg-580, yielding two chains held together by two disulfide bonds. In the absence of the inhibitor, the activation involves additionally the removal of the activation peptide. -
Cellular localization
Secreted. Locates to the cell surface where it is proteolytically cleaved to produce the active plasmin. Interaction with HRG tethers it to the cell surface. - Information by UniProt
-
Database links
- Entrez Gene: 5340 Human
- Entrez Gene: 100172984 Orangutan
- Entrez Gene: 703891 Rhesus monkey
- Omim: 173350 Human
- SwissProt: P00747 Human
- SwissProt: Q5R8X6 Orangutan
- SwissProt: P12545 Rhesus monkey
- Unigene: 143436 Human
-
Form
Cleaved into the following 5 chains: 1.Plasmin heavy chain A2.Activation peptide3.Angiostatin4.Plasmin heavy chain A, short form5. Plasmin light chain B -
Alternative names
- Plasmin antibody
- Plasmin heavy chain A antibody
- Plasmin light chain B antibody
see all
Protocols
Datasheets and documents
References (0)
ab181649 has not yet been referenced specifically in any publications.